-using System.Reflection;
-using System.Runtime.CompilerServices;
-
-//
-// General Information about an assembly is controlled through the following
-// set of attributes. Change these attribute values to modify the information
-// associated with an assembly.
-//
-[assembly: AssemblyTitle("ByteFX.Data.dll")]
-[assembly: AssemblyDescription("ADO.Net drivers for MySql & PostgreSQL")]
-[assembly: AssemblyConfiguration("")]
-[assembly: AssemblyCompany("ByteFX, Inc.")]
-[assembly: AssemblyProduct("")]
-[assembly: AssemblyCopyright("Copyright 2002-2003, ByteFX, Inc.")]
-[assembly: AssemblyTrademark("")]
-[assembly: AssemblyCulture("")]
-
-//
-// Version information for an assembly consists of the following four values:
-//
-// Major Version
-// Minor Version
-// Build Number
-// Revision
-//
-// You can specify all the values or you can default the Revision and Build Numbers
-// by using the '*' as shown below:
-
-#if (NET_2_0)
- [assembly: AssemblyVersion ("0.7.4.2")]
-#elif (NET_1_1)
- [assembly: AssemblyVersion ("0.7.4.1")]
-#else
- [assembly: AssemblyVersion ("0.7.4.0")]
-#endif
-
-[assembly: AssemblyDelaySign (true)]
-[assembly: AssemblyKeyFile ("../mono.pub")]
+using System.Reflection;\r
+using System.Runtime.CompilerServices;\r
+\r
+//\r
+// General Information about an assembly is controlled through the following \r
+// set of attributes. Change these attribute values to modify the information\r
+// associated with an assembly.\r
+//\r
+[assembly: AssemblyTitle("ByteFX.MySqlClient.dll")]\r
+[assembly: AssemblyDescription("ADO.Net driver for MySql")]\r
+[assembly: AssemblyConfiguration("")]\r
+[assembly: AssemblyCompany("ByteFX, Inc.")]\r
+[assembly: AssemblyProduct("")]\r
+[assembly: AssemblyCopyright("Copyright 2002-2004, ByteFX, Inc.")]\r
+[assembly: AssemblyTrademark("")]\r
+[assembly: AssemblyCulture("")] \r
+\r
+//\r
+// Version information for an assembly consists of the following four values:\r
+//\r
+// Major Version\r
+// Minor Version \r
+// Build Number\r
+// Revision\r
+//\r
+// You can specify all the values or you can default the Revision and Build Numbers \r
+// by using the '*' as shown below:\r
+\r
+[assembly: AssemblyVersion("0.7.6.*")]\r
+\r
+//\r
+// In order to sign your assembly you must specify a key to use. Refer to the \r
+// Microsoft .NET Framework documentation for more information on assembly signing.\r
+//\r
+// Use the attributes below to control which key is used for signing. \r
+//\r
+// Notes: \r
+// (*) If no key is specified, the assembly is not signed.\r
+// (*) KeyName refers to a key that has been installed in the Crypto Service\r
+// Provider (CSP) on your machine. KeyFile refers to a file which contains\r
+// a key.\r
+// (*) If the KeyFile and the KeyName values are both specified, the \r
+// following processing occurs:\r
+// (1) If the KeyName can be found in the CSP, that key is used.\r
+// (2) If the KeyName does not exist and the KeyFile does exist, the key \r
+// in the KeyFile is installed into the CSP and used.\r
+// (*) In order to create a KeyFile, you can use the sn.exe (Strong Name) utility.\r
+// When specifying the KeyFile, the location of the KeyFile should be\r
+// relative to the project output directory which is\r
+// %Project Directory%\obj\<configuration>. For example, if your KeyFile is\r
+// located in the project directory, you would specify the AssemblyKeyFile \r
+// attribute as [assembly: AssemblyKeyFile("..\\..\\mykey.snk")]\r
+// (*) Delay Signing is an advanced option - see the Microsoft .NET Framework\r
+// documentation for more information on this.\r
+//\r
+[assembly: AssemblyDelaySign(false)]\r
+#if WINDOWS || !DEBUG\r
+[assembly: AssemblyKeyFile(@"d:\projects\ByteFX\bytefx.snk")]\r
+#endif\r
+[assembly: AssemblyKeyName("")]\r
-11/30/2003
-MySql - Fixed ConnectionSTring editor dialog (thanks marco p (pomarc))
-Common - UserId now supported in connection strings (thanks Jeff Neeley)
-MySql - Attempting to create a parameter that is not input throws an exception (thanks Ryan Gregg)
-
-11/29/2003
-MySql - Added much documentation
-
-11/26/2003
-MySql - checked in new MultiHostStream capability. Big thanks to Dan Guisinger for this. he originally submitted the code and idea of supporting multiple machines on the connect string.
-
-11/25/2003
-MySql - Added alot of documentation. Still alot to do.
-
-11/24/2003
-MySql - Fixed speed issue with 0.73
-
-11/14/2003
-MySql - changed to Thread.Sleep(0) in MySqlDataStream to help optimize the case where it doesn't need to wait (thanks Todd German)
-11/1/2003
-MySql - Prepopulating the idlepools to MinPoolSize
-
-10/31/2003
-MySql - Fixed MySqlPool deadlock condition as well as stupid bug where CreateNewPooledConnection
- was not ever adding new connections to the pool.
- Also fixed MySqlStream.ReadBytes and ReadByte to not use TicksPerSecond which does not appear
- to always be right.
- (thanks Matthew J. Peddlesden)
-MySql - Fix for precision and scale (thanks Matthew J. Peddlesden)
-
-10/28/2003
-MySql - Added Thread.Sleep(1) to stream reading methods to be more cpu friendly (thanks Sean McGinnis)
-
-10/24/2003
-MySql - Fixed problem where ExecuteReader would sometime return null (thanks Lloyd Dupont )
-
-10/17/2003
-MySql - Fixed major bug with null field handling (thanks Naucki)
-
-10/15/2003
-MySql - enclosed queries for max_allowed_packet and characterset inside try catch (and set defaults)
-MySql - fixed problem where socket was not getting closed properly (thanks Steve!)
-
-10/14/2003
-MySql - Fixed problem where ExecuteNonQuery was not always returning the right value
-
-10/13/2003
-MySql - Fixed InternalConnection to not use @@session.max_allowed_packet but use @@max_allowed_packet. (Thanks Miguel)
-
-10/12/2003
-MySql - Added many new XML doc lines
-
-10/10/2003
-MySql - Fixed sql parsing to not send empty queries (thanks Rory)
-MySql - Fixed problem where the reader was not unpeeking the packet on close
-MySql - Fixed problem where user variables were not being handled (thanks Sami Vaaraniemi)
-MySql - Fixed loop checking in the MySqlPool (thanks Steve M. Brown)
-
-10/7/2003
-MySql - Fixed ParameterCollection.Add method to match SqlClient (thanks Joshua Mouch)
-Common & MySql - Fixed ConnectionSTring parsing to handle no and yes for boolean and not lowercase values (thanks Naucki)
-
-10/3/2003
-MySql - Added InternalConnection class, changes to pooling
-Common - Implemented Persist Security Info
-
-9/26/2003
-Common - Added security.cs and version.cs to project
-
-9/25/2003
-MySql - Fixed DateTime handling in Parameter.cs (thanks Burkhard Perkens-Golomb)
-MySql - Fixed parameter serialization where some types would throw a cast exception
-MySql - Fixed DataReader to convert all returned values to prevent casting errors (thanks Keith Murray)
-MySql - Added code to Command.ExecuteReader to return null if the initial SQL command throws an exception (thanks Burkhard Perkens-Golomb)
-
-9/24/2003
-MySql - Fixed ExecuteScalar bug introduced with restructure
-
-9/23/2003
-MySql - Restructure to allow for LOCAL DATA INFILE and better sequencing of packets
-MySql - Fixed several bugs related to restructure.
-
-9/10/2003
-MySql - Early work done to support more secure passwords in Mysql 4.1. Old passwords in 4.1 not supported yet
-
-8/22/2003
-MySql- Parameters appearing after system parameters are now handled correctly (Adam M. (adammil))
-MySql - strings can now be assigned directly to blob fields (Adam M.)
-
-8/20/2003
-MySql - Fixed float parameters (thanks Pent)
-
-8/7/2003
-MySql - Improved Parameter ctor and ParameterCollection.Add methods to better match SqlClient (thx Joshua Mouch )
-MySql - Corrected Connection.CreateCommand to return a MySqlCommand type
-MySql - Fixed connection string designer dialog box problem (thanks Abraham Guyt)
-
-7/24/2003
-MySql - Fixed problem with sending commands not always reading the response packet (thanks Joshua Mouch )
-MySql - Fixed parameter serialization where some blobs types were not being handled (thanks Sean McGinnis )
-
-7/22/2003
-MySql - Removed spurious MessageBox.show from DataReader code (thanks Joshua Mouch )
-
-7/17/2003
-MySql - Fixed a nasty bug in the split sql code (thanks everyone! :-) )
-
-*************Released 0.71***********************
-7/15/2003
-MySql - Fixed bug in MySqlStream where too much data could attempt to be read (thanks Peter Belbin)
-
-7/11/2003
-MySql - Implemented HasRows (thanks Nash Pherson)
-MySql - Fixed bug where tables with more than 252 columns cause an exception ( thanks Joshua Kessler )
-MySql - Fixed bug where SQL statements ending in ; would cause a problem ( thanks Shane Krueger )
-MySql - Fixed bug in driver where error messsages were getting truncated by 1 character (thanks Shane Krueger)
-
-7/6/2003
-========MySql===============
-* Made MySqlException serializable (thanks Mathias Hasselmann)
-
-========PgSql===============
-* Made PgSqlException serializable (thanks Mathias Hasselmann)
-
-***********Released 0.70*********************
-
-6/25/2003
-========MySql===============
-* Updated some of the character code pages to be more accurate
-* Fixed problem where readers could be opened on connections that had readers open
-* Release of 0.70
-
-6/20/2003
-========MySql===============
-* Moved test to separate assembly MySqlClientTests
-
-6/19/2003
-========MySql===============
-* Fixed stupid problem in driver with sequence out of order (Thanks Peter Belbin)
-
-6/18/2003
-========MySql===============
-* Added some pipe tests
-* Increased default max pool size to 50
-* Compiles with Mono 0-24
-
-6/17/2003
-========MySql===============
-* Fixed connection and data reader dispose problems
-* Added String datatype handling to parameter serialization
-
-6/13/2003
-========MySql===============
-* Fixed sequence problem in driver that occured after thrown exception
- (thanks Burkhard Perkens-Golomb)
-
-6/10/2003
-========MySql===============
-* Added support for CommandBehavior.SingleRow to DataReader
-* Fixed command sql processing so quotes are better handled (thanks Theo Spears)
-
-6/9/2003
-========MySQL===============
-* Fixed parsing of double, single, and decimal values to account for non-English separators.
- You still have to use the right syntax if you using hard coded sql, but if you use parameters
- the code will convert floating point types to use '.' appropriately internal both into the server
- and out.
- [ Thanks anonymous ]
-* Added MySqlStream class to simplify timeOuts and driver coding.
-* Fixed DataReader so that it is closed properly when the associated connection is closed.
- [thanks smishra]
-* Made client more SqlClient compliant so that DataReaders have to be closed before the connection
- can be used to run another command
-* Improved DBNull.Value handling in the fields
-* Added several unit tests
-* Fixed MySqlException so that the base class is actually called :-o
-* Improved driver coding
-
-=============PgSql=================
-* Too many changes to document. Still basic structuring of driver. Driver not really usable yet.
-
-
-
-5/28/2003
-* Fixed bug where NextResult was returning false on the last resultset
-* Added more tests for MySQL
-* Improved casting problems by equating unsigned 32bit values to Int64 and usigned 16bit values to Int32, etc
-
-5/6/2003
-* Added new ctor for MySqlParameter for (name, type, size, srccol)
-* Fixed bug in MySqlDataReader where it didn't check for null fieldlist before returning field count
-
-4/23/2003
-* Started adding MySqlClient unit tests (added MySqlClient/Tests folder and some test cases)
-* Fixed some things in Connection String handling
-
-4/7/2003
-* Moved INIT_DB to MySqlPool. I may move it again, this is in preparation of the conference.
-
-4/6/2003
-* Fixed bug inside CommandBuilder that prevented inserts from happening properly
-* Reworked some of the internals so that all three execute methods of Command worked properly
-* FIxed many small bugs found during benchmarking
-
-4/5/2003
-* The first cut of CoonectionPooling is working. "min pool size" and "max pool size" are respected.
-
-4/3/2003
-* Work to enable multiple resultsets to be returned
-* Character sets are handled much more intelligently now. The driver queries MySQL at startup for the default character set.
- That character set is then used for conversions if that code page can be loaded. If not, then the default code
- page for the current OS is used.
-
-3/31/2003
-* Added code to save the inferred type in the name,value ctor of Parameter
-* Also, inferred type if value of null parameter is changed using Value property
-* Converted all files to use proper Camel case. MySQL is now MySql in all files. PgSQL is now PgSql
-* Added attribute to PgSql code to prevent designer from trying to show
-
-3/17/2003
-* Added MySQLDbType property to Parameter object and added proper conversion code to convert from DbType to MySQLDbType)
-* Removed unused ObjectToString method from MySQLParameter.cs
-* Fixed Add(..) method in ParameterCollection so that it doesn't use Add(name, value) instead.
-* Fixed IndexOf and Contains in ParameterCollection to be aware that parameter names are now stored without @
-* Fixed Command.ConvertSQLToBytes so it only allows characters that can be in MySQL variable names
-* Fixed DataReader and Field so that blob fields read their data from Field.cs and GetBytes works right
-* Added simple query builder editor to CommandText property of MySQLCommand
-* Fixed CommandBuilder and Parameter serialization to account for Parameters not storing @ in their names
-* Removed MySQLFieldType enum from Field.cs. Now using MySQLDbType enum
-
-3/15/2003
-* Added Designer attribute to several classes to prevent designer view when using VS.Net
-
-3/13/2003
-* Fixed Initial catalog typo in ConnectionString designer
-* Removed 3 parameter ctor for MySQLParameter that conflicted with (name, type, value)
-* changed MySQLParameter so paramName is now stored without leading @ (this fixed null inserts when using designer)
-* Changed TypeConverter for MySQLParameter to use the ctor with all properties
-
-0.68
-========================================================================
-Note that this build has not been checked out with Mono.
-
-3/10/2003
-* Fixed sequence issue in driver
-
-3/9/2003
-* Added DbParametersEditor to make parameter editing more like SqlClient
-* Fixed Command class so that parameters can be edited using the designer
-
-3/7/2003
-* Update connection string designer to support Use Compression flag
-
-2/15/2003
-* Fixed string encoding so that European characters like ä will work correctly
-
-2/9/2003
-* Creating base classes to aid in building new data providers
-* Added support for UID key in connection string
-
-2/10/2003
-* Field, parameter, command now using DBNull.Value instead of null
-* CommandBuilder using DBNull.Value
-* CommandBuilder now builds insert command correctly when an auto_insert field is not present
-* Field now uses typeof keyword to return System.Types (performance)
-
-0.65
-====================
-* MySQLCommandBuilder now implemented
-* Transaction support now implemented (not all table types support this)
-* GetSchemaTable fixed to not use xsd (for Mono)
-* Driver is now Mono-compatible!!
-* TIME data type now supported
-* More work to improve Timestamp data type handling
-* Changed signatures of all classes to match corresponding SqlClient classes
-
-0.60
-======================
-* Protocol compression using SharpZipLib (www.icsharpcode.net)
-* Named pipes on Windows now working properly
-* Work done to improve Timestamp data type handling
-* Implemented IEnumerable on DataReader so DataGrid would work
-
-0.50
-======================
-* Speed increased dramatically by removing bugging network sync code
-* Driver no longer buffers rows of data (more ADO.Net compliant)
-* Conversion bugs related to TIMESTAMP and DATETIME fields fixed
+3/11/2004\r
+MySql - Changed command editor to point to MySqlClient.Design\r
+\r
+3/4/2004\r
+Common - Fixed bug in Version.isAtLeast\r
+Common - Changed DBConnectionString to support changes done to MySqlConnectionString\r
+Common - Removed SqlCommandEditor and DataAdapterPreviewDialog\r
+\r
+3/3/2004\r
+MySql - Using new long return values in many places\r
+MySql - Integrated new CompressedStream class\r
+\r
+3/2/2004\r
+MySql - Changed ConnectionString and added attributes to allow it to be used in MySqlClient.Design\r
+MySql - Changed packet.cs to support newer lengths in ReadLenInteger\r
+MySql - changed other classes to use new properties and fields of MySqlConnectionString\r
+MySql - ConnectionInternal is now using PING to see if the server is alive\r
+\r
+3/1/2004\r
+MySql - Moved toolbox bitmaps into resource/\r
+MySql - Changed field.cs to allow values to come directly from row buffer\r
+\r
+2/25/2004\r
+MySql - Changed to use the new driver.Send syntax\r
+MySql - Using a new packet queueing system\r
+MySql - started work handling the "broken" compression packet handling\r
+\r
+2/20/2004\r
+Common - Fixed bug in StreamCreator where failure to connect to a host would continue\r
+to loop infinitly (thanks Kevin Casella)\r
+\r
+2/8/2004\r
+MySql - Improved connectstring handling\r
+MySql - Moved designers into Pro product\r
+\r
+2/4/2004\r
+MySql - Removed some old commented out code from command.cs\r
+MySql - Fixed a problem with compression\r
+\r
+2/2/2004\r
+MySql - Fixed connection object where an exception throw prior to the connection opening would not leave\r
+ the connection in the connecting state (thanks Chris Cline )\r
+\r
+1/31/2004\r
+MySql - Added GUID support\r
+MySql - Fixed sequence out of order bug (thanks Mark Reay)\r
+\r
+1/26/2004\r
+MySql - Enum values now supported as parameter values (thanks Philipp Sumi)\r
+1/22/2004\r
+MySql - Year datatype now supported\r
+\r
+1/21/2004\r
+MySql - fixed compression\r
+\r
+1/20/2004\r
+MySql - Fixed bug where a parameter with a TimeSpan as the value would not serialize properly\r
+MySql,Common - Fixed bug where default ctor would not set default connection string values\r
+MySql - Added some XML comments to some members\r
+MySql - Work to fix/improve compression handling\r
+\r
+1/13/2004\r
+MySql,Common - Improved ConnectionString handling so that it better matches the standard set by SqlClient.\r
+MySql - A MySqlException is now thrown if a username is not included in the connection string\r
+MySql- Localhost is now used as the default if not specified on the connection string\r
+MySql - An exception is now thrown if an attempt is made to set the connection string while the connection is open\r
+MySql - Small changes to ConnectionString docs\r
+MySql,common - Removed MultiHostStream and MySqlStream. Replaced it with Common/StreamCreator\r
+MySql - Added support for Use Pipe connection string value\r
+MySql - Added Platform class for easier access to platform utility functions\r
+MySql - Fixed small pooling bug where new connection was not getting created after IsAlive fails\r
+Common - Added Platform.cs and StreamCreator.cs\r
+\r
+12/30/2003\r
+MySql - Fixed Field.cs to properly handle 4.1 style timestamps\r
+MySql - Changed Common.Version to Common.DBVersion to avoid name conflict\r
+\r
+\r
+12/29/2003\r
+MySql - Fixed field.cs so that text columns return the right field type (thanks beni27@gmx.net)\r
+\r
+12/22/2003\r
+MySql - Added MySqlError class to provide some reference for error codes (thanks Geert Veenstra)\r
+\r
+------------0.74 ------------------------\r
+\r
+12/6/2003\r
+MySql - Added Unix socket support (thanks Mohammad DAMT [md@mt.web.id])\r
+\r
+12/4/2003\r
+MySql - only calling Thread.Sleep when no data is available\r
+MySql - improved escaping of quote characters in parameter data\r
+MySql - removed misleading comments from parameter.cs\r
+\r
+12/1/2003\r
+Mysql -fixed pooling bug\r
+MySql - same pooling bug fixed again!! ;-)\r
+\r
+11/30/2003\r
+MySql - Fixed ConnectionSTring editor dialog (thanks marco p (pomarc))\r
+Common - UserId now supported in connection strings (thanks Jeff Neeley)\r
+MySql - Attempting to create a parameter that is not input throws an exception (thanks Ryan Gregg)\r
+\r
+11/29/2003 \r
+MySql - Added much documentation\r
+\r
+11/26/2003\r
+MySql - checked in new MultiHostStream capability. Big thanks to Dan Guisinger for this. he originally submitted the code and idea of supporting multiple machines on the connect string.\r
+\r
+11/25/2003\r
+MySql - Added alot of documentation. Still alot to do.\r
+\r
+11/24/2003\r
+MySql - Fixed speed issue with 0.73\r
+\r
+11/14/2003\r
+MySql - changed to Thread.Sleep(0) in MySqlDataStream to help optimize the case where it doesn't need to wait (thanks Todd German)\r
+11/1/2003\r
+MySql - Prepopulating the idlepools to MinPoolSize\r
+\r
+10/31/2003\r
+MySql - Fixed MySqlPool deadlock condition as well as stupid bug where CreateNewPooledConnection\r
+ was not ever adding new connections to the pool.\r
+ Also fixed MySqlStream.ReadBytes and ReadByte to not use TicksPerSecond which does not appear\r
+ to always be right.\r
+ (thanks Matthew J. Peddlesden)\r
+MySql - Fix for precision and scale (thanks Matthew J. Peddlesden)\r
+\r
+10/28/2003\r
+MySql - Added Thread.Sleep(1) to stream reading methods to be more cpu friendly (thanks Sean McGinnis)\r
+\r
+10/24/2003\r
+MySql - Fixed problem where ExecuteReader would sometime return null (thanks Lloyd Dupont )\r
+\r
+10/17/2003\r
+MySql - Fixed major bug with null field handling (thanks Naucki)\r
+\r
+10/15/2003\r
+MySql - enclosed queries for max_allowed_packet and characterset inside try catch (and set defaults)\r
+MySql - fixed problem where socket was not getting closed properly (thanks Steve!)\r
+\r
+10/14/2003\r
+MySql - Fixed problem where ExecuteNonQuery was not always returning the right value\r
+\r
+10/13/2003\r
+MySql - Fixed InternalConnection to not use @@session.max_allowed_packet but use @@max_allowed_packet. (Thanks Miguel)\r
+\r
+10/12/2003\r
+MySql - Added many new XML doc lines\r
+\r
+10/10/2003\r
+MySql - Fixed sql parsing to not send empty queries (thanks Rory)\r
+MySql - Fixed problem where the reader was not unpeeking the packet on close\r
+MySql - Fixed problem where user variables were not being handled (thanks Sami Vaaraniemi)\r
+MySql - Fixed loop checking in the MySqlPool (thanks Steve M. Brown)\r
+\r
+10/7/2003\r
+MySql - Fixed ParameterCollection.Add method to match SqlClient (thanks Joshua Mouch)\r
+Common & MySql - Fixed ConnectionSTring parsing to handle no and yes for boolean and not lowercase values (thanks Naucki)\r
+\r
+10/3/2003\r
+MySql - Added InternalConnection class, changes to pooling\r
+Common - Implemented Persist Security Info\r
+\r
+9/26/2003\r
+Common - Added security.cs and version.cs to project\r
+\r
+9/25/2003\r
+MySql - Fixed DateTime handling in Parameter.cs (thanks Burkhard Perkens-Golomb)\r
+MySql - Fixed parameter serialization where some types would throw a cast exception\r
+MySql - Fixed DataReader to convert all returned values to prevent casting errors (thanks Keith Murray)\r
+MySql - Added code to Command.ExecuteReader to return null if the initial SQL command throws an exception (thanks Burkhard Perkens-Golomb)\r
+\r
+9/24/2003\r
+MySql - Fixed ExecuteScalar bug introduced with restructure\r
+\r
+9/23/2003\r
+MySql - Restructure to allow for LOCAL DATA INFILE and better sequencing of packets\r
+MySql - Fixed several bugs related to restructure.\r
+\r
+9/10/2003\r
+MySql - Early work done to support more secure passwords in Mysql 4.1. Old passwords in 4.1 not supported yet\r
+\r
+8/22/2003\r
+MySql- Parameters appearing after system parameters are now handled correctly (Adam M. (adammil))\r
+MySql - strings can now be assigned directly to blob fields (Adam M.)\r
+\r
+8/20/2003\r
+MySql - Fixed float parameters (thanks Pent)\r
+\r
+8/7/2003\r
+MySql - Improved Parameter ctor and ParameterCollection.Add methods to better match SqlClient (thx Joshua Mouch )\r
+MySql - Corrected Connection.CreateCommand to return a MySqlCommand type\r
+MySql - Fixed connection string designer dialog box problem (thanks Abraham Guyt)\r
+\r
+7/24/2003\r
+MySql - Fixed problem with sending commands not always reading the response packet (thanks Joshua Mouch )\r
+MySql - Fixed parameter serialization where some blobs types were not being handled (thanks Sean McGinnis )\r
+\r
+7/22/2003\r
+MySql - Removed spurious MessageBox.show from DataReader code (thanks Joshua Mouch )\r
+\r
+7/17/2003\r
+MySql - Fixed a nasty bug in the split sql code (thanks everyone! :-) )\r
+\r
+*************Released 0.71***********************\r
+7/15/2003\r
+MySql - Fixed bug in MySqlStream where too much data could attempt to be read (thanks Peter Belbin)\r
+\r
+7/11/2003\r
+MySql - Implemented HasRows (thanks Nash Pherson)\r
+MySql - Fixed bug where tables with more than 252 columns cause an exception ( thanks Joshua Kessler )\r
+MySql - Fixed bug where SQL statements ending in ; would cause a problem ( thanks Shane Krueger )\r
+MySql - Fixed bug in driver where error messsages were getting truncated by 1 character (thanks Shane Krueger)\r
+\r
+7/6/2003\r
+========MySql===============\r
+* Made MySqlException serializable (thanks Mathias Hasselmann)\r
+\r
+========PgSql===============\r
+* Made PgSqlException serializable (thanks Mathias Hasselmann)\r
+\r
+***********Released 0.70*********************\r
+\r
+6/25/2003\r
+========MySql===============\r
+* Updated some of the character code pages to be more accurate\r
+* Fixed problem where readers could be opened on connections that had readers open\r
+* Release of 0.70\r
+\r
+6/20/2003\r
+========MySql===============\r
+* Moved test to separate assembly MySqlClientTests\r
+\r
+6/19/2003\r
+========MySql===============\r
+* Fixed stupid problem in driver with sequence out of order (Thanks Peter Belbin)\r
+\r
+6/18/2003\r
+========MySql===============\r
+* Added some pipe tests\r
+* Increased default max pool size to 50\r
+* Compiles with Mono 0-24\r
+\r
+6/17/2003\r
+========MySql===============\r
+* Fixed connection and data reader dispose problems\r
+* Added String datatype handling to parameter serialization\r
+\r
+6/13/2003\r
+========MySql===============\r
+* Fixed sequence problem in driver that occured after thrown exception\r
+ (thanks Burkhard Perkens-Golomb)\r
+\r
+6/10/2003\r
+========MySql===============\r
+* Added support for CommandBehavior.SingleRow to DataReader\r
+* Fixed command sql processing so quotes are better handled (thanks Theo Spears)\r
+\r
+6/9/2003\r
+========MySQL===============\r
+* Fixed parsing of double, single, and decimal values to account for non-English separators.\r
+ You still have to use the right syntax if you using hard coded sql, but if you use parameters\r
+ the code will convert floating point types to use '.' appropriately internal both into the server\r
+ and out.\r
+ [ Thanks anonymous ]\r
+* Added MySqlStream class to simplify timeOuts and driver coding.\r
+* Fixed DataReader so that it is closed properly when the associated connection is closed. \r
+ [thanks smishra]\r
+* Made client more SqlClient compliant so that DataReaders have to be closed before the connection\r
+ can be used to run another command\r
+* Improved DBNull.Value handling in the fields\r
+* Added several unit tests\r
+* Fixed MySqlException so that the base class is actually called :-o\r
+* Improved driver coding\r
+\r
+=============PgSql=================\r
+* Too many changes to document. Still basic structuring of driver. Driver not really usable yet.\r
+\r
+\r
+\r
+5/28/2003\r
+* Fixed bug where NextResult was returning false on the last resultset\r
+* Added more tests for MySQL\r
+* Improved casting problems by equating unsigned 32bit values to Int64 and usigned 16bit values to Int32, etc\r
+\r
+5/6/2003\r
+* Added new ctor for MySqlParameter for (name, type, size, srccol)\r
+* Fixed bug in MySqlDataReader where it didn't check for null fieldlist before returning field count\r
+\r
+4/23/2003\r
+* Started adding MySqlClient unit tests (added MySqlClient/Tests folder and some test cases)\r
+* Fixed some things in Connection String handling\r
+\r
+4/7/2003\r
+* Moved INIT_DB to MySqlPool. I may move it again, this is in preparation of the conference.\r
+\r
+4/6/2003\r
+* Fixed bug inside CommandBuilder that prevented inserts from happening properly\r
+* Reworked some of the internals so that all three execute methods of Command worked properly\r
+* FIxed many small bugs found during benchmarking\r
+\r
+4/5/2003\r
+* The first cut of CoonectionPooling is working. "min pool size" and "max pool size" are respected.\r
+\r
+4/3/2003\r
+* Work to enable multiple resultsets to be returned\r
+* Character sets are handled much more intelligently now. The driver queries MySQL at startup for the default character set.\r
+ That character set is then used for conversions if that code page can be loaded. If not, then the default code\r
+ page for the current OS is used. \r
+\r
+3/31/2003\r
+* Added code to save the inferred type in the name,value ctor of Parameter\r
+* Also, inferred type if value of null parameter is changed using Value property\r
+* Converted all files to use proper Camel case. MySQL is now MySql in all files. PgSQL is now PgSql\r
+* Added attribute to PgSql code to prevent designer from trying to show\r
+\r
+3/17/2003\r
+* Added MySQLDbType property to Parameter object and added proper conversion code to convert from DbType to MySQLDbType)\r
+* Removed unused ObjectToString method from MySQLParameter.cs\r
+* Fixed Add(..) method in ParameterCollection so that it doesn't use Add(name, value) instead.\r
+* Fixed IndexOf and Contains in ParameterCollection to be aware that parameter names are now stored without @ \r
+* Fixed Command.ConvertSQLToBytes so it only allows characters that can be in MySQL variable names\r
+* Fixed DataReader and Field so that blob fields read their data from Field.cs and GetBytes works right\r
+* Added simple query builder editor to CommandText property of MySQLCommand\r
+* Fixed CommandBuilder and Parameter serialization to account for Parameters not storing @ in their names\r
+* Removed MySQLFieldType enum from Field.cs. Now using MySQLDbType enum\r
+\r
+3/15/2003\r
+* Added Designer attribute to several classes to prevent designer view when using VS.Net\r
+\r
+3/13/2003\r
+* Fixed Initial catalog typo in ConnectionString designer\r
+* Removed 3 parameter ctor for MySQLParameter that conflicted with (name, type, value)\r
+* changed MySQLParameter so paramName is now stored without leading @ (this fixed null inserts when using designer)\r
+* Changed TypeConverter for MySQLParameter to use the ctor with all properties\r
+\r
+0.68\r
+========================================================================\r
+Note that this build has not been checked out with Mono. \r
+\r
+3/10/2003\r
+* Fixed sequence issue in driver\r
+\r
+3/9/2003\r
+* Added DbParametersEditor to make parameter editing more like SqlClient\r
+* Fixed Command class so that parameters can be edited using the designer\r
+\r
+3/7/2003\r
+* Update connection string designer to support Use Compression flag\r
+\r
+2/15/2003\r
+* Fixed string encoding so that European characters like ä will work correctly\r
+\r
+2/9/2003\r
+* Creating base classes to aid in building new data providers\r
+* Added support for UID key in connection string\r
+\r
+2/10/2003\r
+* Field, parameter, command now using DBNull.Value instead of null\r
+* CommandBuilder using DBNull.Value\r
+* CommandBuilder now builds insert command correctly when an auto_insert field is not present\r
+* Field now uses typeof keyword to return System.Types (performance)\r
+\r
+0.65\r
+====================\r
+* MySQLCommandBuilder now implemented\r
+* Transaction support now implemented (not all table types support this)\r
+* GetSchemaTable fixed to not use xsd (for Mono)\r
+* Driver is now Mono-compatible!!\r
+* TIME data type now supported\r
+* More work to improve Timestamp data type handling\r
+* Changed signatures of all classes to match corresponding SqlClient classes\r
+\r
+0.60\r
+======================\r
+* Protocol compression using SharpZipLib (www.icsharpcode.net)\r
+* Named pipes on Windows now working properly\r
+* Work done to improve Timestamp data type handling\r
+* Implemented IEnumerable on DataReader so DataGrid would work\r
+ \r
+0.50\r
+======================\r
+* Speed increased dramatically by removing bugging network sync code\r
+* Driver no longer buffers rows of data (more ADO.Net compliant)\r
+* Conversion bugs related to TIMESTAMP and DATETIME fields fixed\r
-using System;
-using System.IO;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for BitStream.
- /// </summary>
- public class BitStream : MemoryStream
- {
- private byte[] _input;
- private int _start;
- private int _end;
- private int _bitindex;
- private uint _bitbuffer;
- private int _bits_in_buffer;
-
- public BitStream(byte[] input, int index, int len)
- {
- _bitindex = 0;
- _bitbuffer = 0;
- _bits_in_buffer = 0;
- _input = input;
- _start = index;
- _end = _start + len;
- }
-
- public int GetBits(int numbits)
- {
- return 0;
- }
-
- public int PeekBits(int numbits)
- {
- int val=0;
-
- int index=_start;
- while (numbits > 0)
- {
- val = (val << 8) | _input[index++];
- numbits -= 8;
- }
-
- while (_bits_in_buffer < numbits)
- {
- if (_start == _end)
- throw new Exception("Out of bits");
- byte b = _input[_start++];
- }
- return 0;
- }
- }
-}
+using System;\r
+using System.IO;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for BitStream.\r
+ /// </summary>\r
+ public class BitStream : MemoryStream\r
+ {\r
+ private byte[] _input;\r
+ private int _start;\r
+ private int _end;\r
+ private int _bitindex;\r
+ private uint _bitbuffer;\r
+ private int _bits_in_buffer;\r
+\r
+ public BitStream(byte[] input, int index, int len)\r
+ {\r
+ _bitindex = 0;\r
+ _bitbuffer = 0;\r
+ _bits_in_buffer = 0;\r
+ _input = input;\r
+ _start = index;\r
+ _end = _start + len;\r
+ }\r
+\r
+ public int GetBits(int numbits)\r
+ {\r
+ return 0;\r
+ }\r
+\r
+ public int PeekBits(int numbits)\r
+ {\r
+ int val=0;\r
+\r
+ int index=_start;\r
+ while (numbits > 0)\r
+ {\r
+ val = (val << 8) | _input[index++];\r
+ numbits -= 8;\r
+ }\r
+\r
+ while (_bits_in_buffer < numbits)\r
+ {\r
+ if (_start == _end)\r
+ throw new Exception("Out of bits");\r
+ byte b = _input[_start++];\r
+ }\r
+ return 0;\r
+ }\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.ComponentModel;
-using System.Collections.Specialized;
-using System.Data;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for Connection.
- /// </summary>
- [ToolboxItem(false)]
- [System.ComponentModel.DesignerCategory("Code")]
- public class Connection : Component
- {
- internal ConnectionString connString;
- internal ConnectionState state;
- internal IDataReader reader = null;
-
-
- public Connection(System.ComponentModel.IContainer container)
- {
- /// <summary>
- /// Required for Windows.Forms Class Composition Designer support
- /// </summary>
- container.Add(this);
- Init();
- }
-
- public Connection()
- {
- Init();
- }
-
- protected void Init()
- {
- state = ConnectionState.Closed;
- }
-
-
- [Browsable(true)]
- public string DataSource
- {
- get
- {
- String s = connString["data source"];
- if (s == null || s.Length == 0)
- return "localhost";
- return s;
- }
- }
-
- [Browsable(false)]
- public string User
- {
- get
- {
- string s = connString["user id"];
- if (s == null)
- s = "";
- return s;
- }
- }
-
- [Browsable(false)]
- public string Password
- {
- get
- {
- string pwd = connString["password"];
- if (pwd == null)
- pwd = "";
- return pwd;
- }
- }
-
- [Browsable(true)]
- public int ConnectionTimeout
- {
- get
- {
- // Returns the connection time-out value set in the connection
- // string. Zero indicates an indefinite time-out period.
- if (connString == null)
- return 30;
- return connString.GetIntOption("connection timeout", 30);
- }
- }
-
- [Browsable(true)]
- public string Database
- {
- get
- {
- // Returns an initial database as set in the connection string.
- // An empty string indicates not set - do not return a null reference.
- return connString["database"];
- }
- }
-
- [Browsable(false)]
- public ConnectionState State
- {
- get { return state; }
- }
-
- internal IDataReader Reader
- {
- get { return reader; }
- set { reader = value; }
- }
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.ComponentModel;\r
+using System.Collections.Specialized;\r
+using System.Data;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for Connection.\r
+ /// </summary>\r
+ [ToolboxItem(false)]\r
+ [System.ComponentModel.DesignerCategory("Code")]\r
+ public class Connection : Component\r
+ {\r
+ internal ConnectionString connString;\r
+ internal ConnectionState state;\r
+ internal IDataReader reader = null;\r
+\r
+\r
+ public Connection(System.ComponentModel.IContainer container)\r
+ {\r
+ /// <summary>\r
+ /// Required for Windows.Forms Class Composition Designer support\r
+ /// </summary>\r
+ container.Add(this);\r
+ Init();\r
+ }\r
+\r
+ public Connection()\r
+ {\r
+ Init();\r
+ }\r
+\r
+ protected void Init() \r
+ {\r
+ state = ConnectionState.Closed;\r
+ }\r
+\r
+\r
+ [Browsable(true)]\r
+ public string DataSource\r
+ {\r
+ get\r
+ {\r
+ String s = connString["data source"];\r
+ if (s == null || s.Length == 0)\r
+ return "localhost";\r
+ return s;\r
+ }\r
+ }\r
+\r
+ [Browsable(false)]\r
+ public string User\r
+ {\r
+ get\r
+ {\r
+ string s = connString["user id"];\r
+ if (s == null)\r
+ s = "";\r
+ return s;\r
+ }\r
+ }\r
+\r
+ [Browsable(false)]\r
+ public string Password\r
+ {\r
+ get\r
+ {\r
+ string pwd = connString["password"];\r
+ if (pwd == null)\r
+ pwd = "";\r
+ return pwd;\r
+ }\r
+ }\r
+\r
+ [Browsable(true)]\r
+ public int ConnectionTimeout\r
+ {\r
+ get\r
+ {\r
+ // Returns the connection time-out value set in the connection\r
+ // string. Zero indicates an indefinite time-out period.\r
+ if (connString == null)\r
+ return 30;\r
+ return connString.GetIntOption("connection timeout", 30);\r
+ }\r
+ }\r
+ \r
+ [Browsable(true)]\r
+ public string Database\r
+ {\r
+ get \r
+ { \r
+ // Returns an initial database as set in the connection string.\r
+ // An empty string indicates not set - do not return a null reference.\r
+ return connString["database"];\r
+ }\r
+ }\r
+\r
+ [Browsable(false)]\r
+ public ConnectionState State\r
+ {\r
+ get { return state; }\r
+ }\r
+\r
+ internal IDataReader Reader\r
+ {\r
+ get { return reader; }\r
+ set { reader = value; }\r
+ }\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Collections.Specialized;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for Utility.
- /// </summary>
- internal class ConnectionString
- {
- private StringDictionary elements;
- private string connString;
-
- public ConnectionString(string connString)
- {
- this.connString = connString;
- elements = new StringDictionary();
- Parse( connString );
- }
-
- public string Value
- {
- get { return connString; }
- }
-
- public string this[string key]
- {
- get
- {
- string val = elements[key];
- return val;
- }
- }
-
- public int GetIntOption( string key, int defaultvalue )
- {
- string val = this[ key ];
- if (null == val) return defaultvalue;
- return Convert.ToInt32( val );
- }
-
- public bool GetBoolOption( string key, bool defaultvalue )
- {
- string val = this[ key ];
- if (null == val) return defaultvalue;
- val = val.ToLower();
- if (val == "true" || val == "yes") return true;
- return false;
- }
-
- public bool Contains( string key )
- {
- return elements.ContainsKey(key);
- }
-
- public bool Equals( ConnectionString obj )
- {
- foreach (string key in elements.Keys)
- {
- if (! obj.Contains(key)) return false;
- if ( ! this[key].Equals( obj[key] )) return false;
- }
- return true;
- }
-
- /// <summary>
- ///
- /// </summary>
- /// <param name="obj"></param>
- /// <returns></returns>
- public bool PoolingEquals( ConnectionString obj )
- {
- foreach (string key in elements.Keys)
- {
- // these connection string elements only affect pooling
- // so we don't check them when making sure connection strings
- // are alike
- if (key.Equals("connection lifetime")) continue;
- if (key.Equals("connection reset")) continue;
- if (key.Equals("enlist")) continue;
- if (key.Equals("max pool size")) continue;
- if (key.Equals("min pool size")) continue;
- if (key.Equals("pooling")) continue;
-
- if (! obj.Contains(key)) return false;
- if ( ! this[key].Equals( obj[key] )) return false;
- }
- return true;
- }
-
- /// <summary>
- ///
- /// </summary>
- /// <param name="s"></param>
- public void Parse( String s )
- {
- String[] keyvalues = s.Split( ';' );
- String[] newkeyvalues = new String[keyvalues.Length];
- int x = 0;
-
- elements.Clear();
-
- // first run through the array and check for any keys that
- // have ; in their value
- foreach (String keyvalue in keyvalues)
- {
- // check for trailing ; at the end of the connection string
- if (keyvalue.Length == 0) continue;
-
- // this value has an '=' sign so we are ok
- if (keyvalue.IndexOf('=') >= 0)
- {
- newkeyvalues[x++] = keyvalue;
- }
- else
- {
- newkeyvalues[x-1] += ";";
- newkeyvalues[x-1] += keyvalue;
- }
- }
-
- // now we run through our normalized key-values, splitting on equals
- for (int y=0; y < x; y++)
- {
- String[] parts = newkeyvalues[y].Split( '=' );
-
- // first trim off any space and lowercase the key
- parts[0] = parts[0].Trim().ToLower();
- parts[1] = parts[1].Trim();
-
- // normalize the keys going in. We want to support the same synonyms that
- // SqlClient supports
- switch (parts[0])
- {
- case "uid": parts[0] = "user id"; break;
- case "pwd": parts[0] = "password"; break;
- case "user": parts[0] = "user id"; break;
- case "initial catalog": parts[0] = "database"; break;
- case "server": parts[0] = "data source"; break;
- }
-
- // we also want to clear off any quotes
- String newvalue = parts[1].Trim( '\'' );
- if (newvalue.Length == parts[1].Length)
- {
- newvalue = parts[1].Trim('"');
- }
- parts[1] = newvalue;
-
- // make sure we don't get dupliate keys
- if (elements.ContainsKey(parts[0]))
- {
- throw new ArgumentException("Duplicate key in connection string", parts[0]);
- }
-
- elements.Add( parts[0], parts[1] );
-
- // now put the correct parsed string into the connection string !! (AG 4/8/2003)
- connString="";
- foreach(string key in elements.Keys)
- {
- connString=connString+key+"="+elements[key]+"; ";
- }
- connString=connString.Substring(0,connString.Length-2);
- }
- }
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Collections.Specialized;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for Utility.\r
+ /// </summary>\r
+ internal class ConnectionString\r
+ {\r
+ private StringDictionary elements;\r
+ private string connString;\r
+\r
+ public ConnectionString(string connString)\r
+ {\r
+ this.connString = connString;\r
+ elements = new StringDictionary();\r
+ Parse( connString );\r
+ }\r
+\r
+ public string Value\r
+ {\r
+ get { return connString; }\r
+ }\r
+\r
+ public string this[string key] \r
+ {\r
+ get \r
+ { \r
+ string val = elements[key];\r
+ return val;\r
+ }\r
+ }\r
+\r
+ public int GetIntOption( string key, int defaultvalue ) \r
+ {\r
+ string val = this[ key ];\r
+ if (null == val) return defaultvalue;\r
+ return Convert.ToInt32( val );\r
+ }\r
+\r
+ public bool GetBoolOption( string key, bool defaultvalue ) \r
+ {\r
+ string val = this[ key ];\r
+ if (null == val) return defaultvalue;\r
+ val = val.ToLower();\r
+ if (val == "true" || val == "yes") return true;\r
+ return false;\r
+ }\r
+\r
+ public bool Contains( string key ) \r
+ {\r
+ return elements.ContainsKey(key);\r
+ }\r
+\r
+ public bool Equals( ConnectionString obj ) \r
+ {\r
+ foreach (string key in elements.Keys) \r
+ {\r
+ if (! obj.Contains(key)) return false;\r
+ if ( ! this[key].Equals( obj[key] )) return false;\r
+ }\r
+ return true;\r
+ }\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ /// <param name="obj"></param>\r
+ /// <returns></returns>\r
+ public bool PoolingEquals( ConnectionString obj ) \r
+ {\r
+ foreach (string key in elements.Keys) \r
+ {\r
+ // these connection string elements only affect pooling\r
+ // so we don't check them when making sure connection strings\r
+ // are alike\r
+ if (key.Equals("connection lifetime")) continue;\r
+ if (key.Equals("connection reset")) continue;\r
+ if (key.Equals("enlist")) continue;\r
+ if (key.Equals("max pool size")) continue;\r
+ if (key.Equals("min pool size")) continue;\r
+ if (key.Equals("pooling")) continue;\r
+\r
+ if (! obj.Contains(key)) return false;\r
+ if ( ! this[key].Equals( obj[key] )) return false;\r
+ }\r
+ return true;\r
+ }\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ /// <param name="s"></param>\r
+ public void Parse( String s ) \r
+ {\r
+ String[] keyvalues = s.Split( ';' );\r
+ String[] newkeyvalues = new String[keyvalues.Length];\r
+ int x = 0;\r
+\r
+ elements.Clear();\r
+\r
+ // first run through the array and check for any keys that\r
+ // have ; in their value\r
+ foreach (String keyvalue in keyvalues) \r
+ {\r
+ // check for trailing ; at the end of the connection string\r
+ if (keyvalue.Length == 0) continue;\r
+\r
+ // this value has an '=' sign so we are ok\r
+ if (keyvalue.IndexOf('=') >= 0) \r
+ {\r
+ newkeyvalues[x++] = keyvalue;\r
+ }\r
+ else \r
+ {\r
+ newkeyvalues[x-1] += ";";\r
+ newkeyvalues[x-1] += keyvalue;\r
+ }\r
+ }\r
+\r
+ // now we run through our normalized key-values, splitting on equals\r
+ for (int y=0; y < x; y++) \r
+ {\r
+ String[] parts = newkeyvalues[y].Split( '=' );\r
+\r
+ // first trim off any space and lowercase the key\r
+ parts[0] = parts[0].Trim().ToLower();\r
+ parts[1] = parts[1].Trim();\r
+\r
+ // normalize the keys going in. We want to support the same synonyms that\r
+ // SqlClient supports\r
+ switch (parts[0]) \r
+ {\r
+ case "uid": parts[0] = "user id"; break;\r
+ case "pwd": parts[0] = "password"; break;\r
+ case "user": parts[0] = "user id"; break;\r
+ case "initial catalog": parts[0] = "database"; break;\r
+ case "server": parts[0] = "data source"; break;\r
+ }\r
+\r
+ // we also want to clear off any quotes\r
+ String newvalue = parts[1].Trim( '\'' );\r
+ if (newvalue.Length == parts[1].Length) \r
+ {\r
+ newvalue = parts[1].Trim('"');\r
+ }\r
+ parts[1] = newvalue;\r
+\r
+ // make sure we don't get dupliate keys\r
+ if (elements.ContainsKey(parts[0])) \r
+ {\r
+ throw new ArgumentException("Duplicate key in connection string", parts[0]);\r
+ }\r
+\r
+ elements.Add( parts[0], parts[1] );\r
+\r
+ // now put the correct parsed string into the connection string !! (AG 4/8/2003)\r
+ connString="";\r
+ foreach(string key in elements.Keys)\r
+ {\r
+ connString=connString+key+"="+elements[key]+"; ";\r
+ }\r
+ connString=connString.Substring(0,connString.Length-2);\r
+ }\r
+ }\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Collections;
-using System.Text;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for Utility.
- /// </summary>
- internal class DBConnectionString
- {
- protected Hashtable keyValues = new Hashtable();
- protected string connectString;
- protected string host;
- protected string username;
- protected string password;
- protected string database;
- protected int connectTimeout;
- protected int port;
- protected int maxPoolSize;
- protected int minPoolSize;
- protected int connectLifetime;
- protected bool pooling;
- protected bool persistSecurityInfo;
-
- public DBConnectionString()
- {
- persistSecurityInfo = false;
- }
-
- public DBConnectionString(string connectString) : this()
- {
- this.connectString = connectString;
- }
-
- #region Properties
- public string Host
- {
- get { return host; }
- }
-
- public string Username
- {
- get { return username; }
- }
-
- public string Password
- {
- get { return password; }
- }
-
- public int ConnectTimeout
- {
- get { return connectTimeout; }
- }
-
- public string Database
- {
- get { return database; }
- }
-
- public int Port
- {
- get { return port; }
- }
-
- public int MaxPoolSize
- {
- get { return maxPoolSize; }
- }
-
- public int MinPoolSize
- {
- get { return minPoolSize; }
- }
-
- public bool Pooling
- {
- get { return pooling; }
- }
-
- public int ConnectionLifetime
- {
- get { return connectLifetime; }
- }
-
- public string ConnectString
- {
- get { return GetConnectionString(); }
- set { connectString = value; Parse(); }
- }
-
- #endregion
-
- private string GetConnectionString()
- {
- StringBuilder str = new StringBuilder();
-
- foreach ( string key in keyValues.Keys)
- {
- if ((key.ToLower() == "pwd" || key.ToLower() == "password") &&
- !persistSecurityInfo) continue;
- str.AppendFormat("{0}={1};", key, keyValues[key]);
- }
-
- if (str.Length > 0)
- str.Remove( str.Length-1, 1 );
-
- return str.ToString();
- }
-
- protected virtual void ConnectionParameterParsed(string key, string value)
- {
- switch (key.ToLower())
- {
- case "persist security info":
- if (value.ToLower() == "no" || value.ToLower() == "false")
- persistSecurityInfo = false;
- else
- persistSecurityInfo = true;
- break;
-
- case "uid":
- case "username":
- case "user id":
- case "user name":
- case "userid":
- username = value;
- break;
-
- case "password":
- case "pwd":
- password = value;
- break;
-
- case "host":
- case "server":
- case "data source":
- case "datasource":
- case "address":
- case "addr":
- case "network address":
- host = value;
- break;
-
- case "initial catalog":
- case "database":
- database = value;
- break;
-
- case "connection timeout":
- case "connect timeout":
- connectTimeout = Int32.Parse( value );
- break;
-
- case "port":
- port = Int32.Parse( value );
- break;
-
- case "pooling":
- if (value.ToLower() == "no" || value.ToLower() == "false")
- pooling = false;
- else
- pooling = true;
- break;
-
- case "min pool size":
- minPoolSize = Int32.Parse(value);
- break;
-
- case "max pool size":
- maxPoolSize = Int32.Parse(value);
- break;
-
- case "connection lifetime":
- connectLifetime = Int32.Parse(value);
- break;
- }
- }
-
- protected void Parse()
- {
- String[] keyvalues = connectString.Split( ';' );
- String[] newkeyvalues = new String[keyvalues.Length];
- int x = 0;
-
- // first run through the array and check for any keys that
- // have ; in their value
- foreach (String keyvalue in keyvalues)
- {
- // check for trailing ; at the end of the connection string
- if (keyvalue.Length == 0) continue;
-
- // this value has an '=' sign so we are ok
- if (keyvalue.IndexOf('=') >= 0)
- {
- newkeyvalues[x++] = keyvalue;
- }
- else
- {
- newkeyvalues[x-1] += ";";
- newkeyvalues[x-1] += keyvalue;
- }
- }
-
- keyValues.Clear();
-
- // now we run through our normalized key-values, splitting on equals
- for (int y=0; y < x; y++)
- {
- String[] parts = newkeyvalues[y].Split( '=' );
-
- // first trim off any space and lowercase the key
- parts[0] = parts[0].Trim().ToLower();
- parts[1] = parts[1].Trim();
-
- // we also want to clear off any quotes
- parts[0] = parts[0].Trim('\'', '"');
- parts[1] = parts[1].Trim('\'', '"');
-
- ConnectionParameterParsed( parts[0], parts[1] );
- keyValues.Add( parts[0], parts[1] );
- }
- }
-
-
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Collections;\r
+using System.Text;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for Utility.\r
+ /// </summary>\r
+ internal abstract class DBConnectionString\r
+ {\r
+ protected Hashtable keyValues = new Hashtable();\r
+ protected string connectionName = String.Empty;\r
+ protected string connectString;\r
+\r
+ public DBConnectionString()\r
+ { \r
+ keyValues = GetDefaultValues();\r
+ }\r
+\r
+ public void SetConnectionString(string value)\r
+ {\r
+ Hashtable ht = Parse( value ); \r
+ connectString = value;\r
+ keyValues = ht;\r
+ }\r
+\r
+ protected string GetString(string name) \r
+ {\r
+ if (! keyValues.ContainsKey(name)) return String.Empty;\r
+ return (keyValues[name] as string);\r
+ }\r
+\r
+ protected int GetInt( string name ) \r
+ {\r
+ return Convert.ToInt32(keyValues[name]);\r
+ }\r
+\r
+ protected bool GetBool( string name ) \r
+ {\r
+ return Convert.ToBoolean(keyValues[name]);\r
+ }\r
+\r
+ protected virtual bool ConnectionParameterParsed(Hashtable hash, string key, string value)\r
+ {\r
+ switch (key.ToLower()) \r
+ {\r
+ case "persist security info":\r
+ hash["persist security info"] = \r
+ value.ToLower() == "yes" || value.ToLower() == "true";\r
+ return true;\r
+\r
+ case "uid":\r
+ case "username":\r
+ case "user id":\r
+ case "user name": \r
+ case "userid":\r
+ hash["user id"] = value;\r
+ return true;\r
+\r
+ case "password": \r
+ case "pwd":\r
+ hash["password"] = value;\r
+ return true;\r
+\r
+ case "host":\r
+ case "server":\r
+ case "data source":\r
+ case "datasource":\r
+ case "address":\r
+ case "addr":\r
+ case "network address":\r
+ hash["host"] = value;\r
+ return true;\r
+ \r
+ case "initial catalog":\r
+ case "database":\r
+ hash["database"] = value;\r
+ return true;\r
+\r
+ case "connection timeout":\r
+ case "connect timeout":\r
+ hash["connect timeout"] = Int32.Parse( value );\r
+ return true;\r
+\r
+ case "port":\r
+ hash["port"] = Int32.Parse( value );\r
+ return true;\r
+\r
+ case "pooling":\r
+ hash["pooling"] = \r
+ value.ToLower() == "yes" || value.ToLower() == "true";\r
+ return true;\r
+\r
+ case "min pool size":\r
+ hash["min pool size"] = Int32.Parse(value);\r
+ return true;\r
+\r
+ case "max pool size":\r
+ hash["max pool size"] = Int32.Parse(value);\r
+ return true;\r
+\r
+ case "connection lifetime":\r
+ hash["connect lifetime"] = Int32.Parse(value);\r
+ return true;\r
+ }\r
+ return false;\r
+ }\r
+\r
+ protected virtual Hashtable GetDefaultValues()\r
+ {\r
+ return null;\r
+ }\r
+\r
+ protected Hashtable ParseKeyValuePairs( string src )\r
+ {\r
+ String[] keyvalues = src.Split( ';' );\r
+ String[] newkeyvalues = new String[keyvalues.Length];\r
+ int x = 0;\r
+\r
+ // first run through the array and check for any keys that\r
+ // have ; in their value\r
+ foreach (String keyvalue in keyvalues) \r
+ {\r
+ // check for trailing ; at the end of the connection string\r
+ if (keyvalue.Length == 0) continue;\r
+\r
+ // this value has an '=' sign so we are ok\r
+ if (keyvalue.IndexOf('=') >= 0) \r
+ {\r
+ newkeyvalues[x++] = keyvalue;\r
+ }\r
+ else \r
+ {\r
+ newkeyvalues[x-1] += ";";\r
+ newkeyvalues[x-1] += keyvalue;\r
+ }\r
+ }\r
+\r
+ Hashtable hash = new Hashtable();\r
+\r
+ // now we run through our normalized key-values, splitting on equals\r
+ for (int y=0; y < x; y++) \r
+ {\r
+ String[] parts = newkeyvalues[y].Split( '=' );\r
+\r
+ // first trim off any space and lowercase the key\r
+ parts[0] = parts[0].Trim().ToLower();\r
+ parts[1] = parts[1].Trim();\r
+\r
+ // we also want to clear off any quotes\r
+ parts[0] = parts[0].Trim('\'', '"');\r
+ parts[1] = parts[1].Trim('\'', '"');\r
+\r
+ hash.Add( parts[0], parts[1] );\r
+ }\r
+ return hash;\r
+ }\r
+\r
+ protected virtual Hashtable Parse(string newConnectString) \r
+ {\r
+ Hashtable hash = ParseKeyValuePairs( newConnectString );\r
+ Hashtable newHash = GetDefaultValues();\r
+\r
+ foreach (object key in hash.Keys)\r
+ ConnectionParameterParsed( newHash, (string)key, (string)hash[key] );\r
+ return newHash;\r
+ }\r
+\r
+\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.ComponentModel.Design;
-using ByteFX.Data.MySqlClient;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for DBParametersEditor.
- /// </summary>
- internal class DBParametersEditor : CollectionEditor
- {
- public DBParametersEditor(Type t) : base(t)
- {
- }
-
- protected override object CreateInstance(Type itemType)
- {
- object[] items = base.GetItems(null);
-
- int i = 1;
- while (true)
- {
- bool found = false;
- foreach (object obj in items)
- {
- MySqlParameter p = (MySqlParameter)obj;
- if (p.ParameterName.Equals( "parameter" + i ))
- {
- found = true;
- break;
- }
- }
- if (! found) break;
- i ++;
- }
-
- MySqlParameter parm = new MySqlParameter("parameter"+i, MySqlDbType.VarChar);
- return parm;
- }
-
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.ComponentModel.Design;\r
+using ByteFX.Data.MySqlClient;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for DBParametersEditor.\r
+ /// </summary>\r
+ internal class DBParametersEditor : CollectionEditor\r
+ {\r
+ public DBParametersEditor(Type t) : base(t)\r
+ {\r
+ }\r
+\r
+ protected override object CreateInstance(Type itemType)\r
+ {\r
+ object[] items = base.GetItems(null);\r
+\r
+ int i = 1;\r
+ while (true) \r
+ {\r
+ bool found = false;\r
+ foreach (object obj in items) \r
+ {\r
+ MySqlParameter p = (MySqlParameter)obj;\r
+ if (p.ParameterName.Equals( "parameter" + i )) \r
+ {\r
+ found = true;\r
+ break;\r
+ }\r
+ }\r
+ if (! found) break;\r
+ i ++;\r
+ }\r
+\r
+ MySqlParameter parm = new MySqlParameter("parameter"+i, MySqlDbType.VarChar);\r
+ return parm;\r
+ }\r
+\r
+ }\r
+}\r
-using System;
-using System.Data;
-using System.Data.SqlTypes;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for Field.
- /// </summary>
- internal class Field
- {
-/* protected SqlByte byteValue;
- protected SqlDateTime dateValue;
- protected SqlString stringValue;
- protected SqlInt32 int32Value;
- protected SqlInt64 int64Value;
- protected SqlDouble doubleValue;
- protected SqlSingle singleValue;
- protected SqlMoney moneyValue;
- protected SqlDecimal decimalValue;
- protected SqlBinary binaryValue;*/
- protected object value;
-
- protected string tableName;
- protected string colName;
- protected int colLen;
- protected DbType dbType;
- protected bool hasValue;
-
- public Field()
- {
- hasValue = false;
- }
-
- public string ColumnName
- {
- get { return colName; }
- }
-
- public int ColumnLength
- {
- get { return colLen; }
- }
-
- public string TableName
- {
- get { return tableName; }
- }
-
- }
-}
+using System;\r
+using System.Data;\r
+using System.Data.SqlTypes;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for Field.\r
+ /// </summary>\r
+ internal class Field\r
+ {\r
+/* protected SqlByte byteValue;\r
+ protected SqlDateTime dateValue;\r
+ protected SqlString stringValue;\r
+ protected SqlInt32 int32Value;\r
+ protected SqlInt64 int64Value;\r
+ protected SqlDouble doubleValue;\r
+ protected SqlSingle singleValue;\r
+ protected SqlMoney moneyValue;\r
+ protected SqlDecimal decimalValue;\r
+ protected SqlBinary binaryValue;*/\r
+ protected object value;\r
+\r
+ protected string tableName;\r
+ protected string colName;\r
+ protected int colLen;\r
+ protected string catalogName;\r
+ protected DbType dbType;\r
+ protected bool hasValue;\r
+\r
+ public Field()\r
+ {\r
+ hasValue = false;\r
+ }\r
+\r
+ public string ColumnName \r
+ {\r
+ get { return colName; }\r
+ set { colName = value; }\r
+ }\r
+\r
+ public int ColumnLength\r
+ {\r
+ get { return colLen; }\r
+ set { colLen = value; }\r
+ }\r
+\r
+ public string TableName \r
+ {\r
+ get { return tableName; }\r
+ set { tableName = value; }\r
+ }\r
+\r
+ public string CatalogName \r
+ {\r
+ get { return catalogName; }\r
+ set { catalogName = value; }\r
+ }\r
+\r
+ }\r
+}\r
-using System;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for HuffmanTree.
- /// </summary>
- public class HuffmanTree
- {
- const int MAX_BITS = 15;
- int[] codes;
-
- public HuffmanTree(bool lit)
- {
- if (lit)
- BuildLitTree();
- else
- BuildLenTree();
- }
-
- private void BuildLitTree()
- {
- codes = new int[288];
-
- // fill the code slots with code lengths first
- for (int x=0; x < 144; x++)
- codes[x] = 8;
- for (int x=144; x < 256; x++)
- codes[x] = 9;
- for (int x=256; x < 280; x++)
- codes[x] = 7;
- for (int x=280; x < 288; x++)
- codes[x] = 8;
-
- BuildTreeCommon();
- }
-
-
- private void BuildLenTree()
- {
- BuildTreeCommon();
- }
-
- private void BuildTreeCommon()
- {
- int[] codecounts = new int[MAX_BITS];
- int[] codebase = new int[MAX_BITS];
-
- for (int i = 0; i < codes.Length; i++)
- {
- int bit_len = codes[i];
- if (bit_len > 0)
- codecounts[bit_len]++;
- }
-
- // now we compute the intial value for each code length
- int code = 0;
- codecounts[0] = 0;
- for (int bits = 1; bits <= MAX_BITS; bits++)
- {
- code = (code + codecounts[bits-1]) << 1;
- codebase[bits] = code;
- }
-
- // next we assign numerical values to each code
- for (int x=0; x <= codes.Length; x++)
- {
- if (codes[x] == 0) continue;
- int blen = codes[x];
- codes[x] = codebase[ blen ];
- codebase[ blen ] ++;
- }
- }
-
- }
-}
+using System;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for HuffmanTree.\r
+ /// </summary>\r
+ public class HuffmanTree\r
+ {\r
+ const int MAX_BITS = 15;\r
+ int[] codes;\r
+\r
+ public HuffmanTree(bool lit)\r
+ {\r
+ if (lit)\r
+ BuildLitTree();\r
+ else\r
+ BuildLenTree();\r
+ }\r
+\r
+ private void BuildLitTree()\r
+ {\r
+ codes = new int[288];\r
+\r
+ // fill the code slots with code lengths first\r
+ for (int x=0; x < 144; x++)\r
+ codes[x] = 8;\r
+ for (int x=144; x < 256; x++)\r
+ codes[x] = 9;\r
+ for (int x=256; x < 280; x++)\r
+ codes[x] = 7;\r
+ for (int x=280; x < 288; x++)\r
+ codes[x] = 8;\r
+\r
+ BuildTreeCommon();\r
+ }\r
+\r
+\r
+ private void BuildLenTree()\r
+ {\r
+ BuildTreeCommon();\r
+ }\r
+\r
+ private void BuildTreeCommon()\r
+ {\r
+ int[] codecounts = new int[MAX_BITS];\r
+ int[] codebase = new int[MAX_BITS];\r
+\r
+ for (int i = 0; i < codes.Length; i++) \r
+ {\r
+ int bit_len = codes[i];\r
+ if (bit_len > 0)\r
+ codecounts[bit_len]++;\r
+ }\r
+\r
+ // now we compute the intial value for each code length\r
+ int code = 0;\r
+ codecounts[0] = 0;\r
+ for (int bits = 1; bits <= MAX_BITS; bits++) \r
+ {\r
+ code = (code + codecounts[bits-1]) << 1;\r
+ codebase[bits] = code;\r
+ }\r
+\r
+ // next we assign numerical values to each code\r
+ for (int x=0; x <= codes.Length; x++) \r
+ {\r
+ if (codes[x] == 0) continue;\r
+ int blen = codes[x];\r
+ codes[x] = codebase[ blen ];\r
+ codebase[ blen ] ++;\r
+ }\r
+ }\r
+\r
+ }\r
+}\r
-using System;
-using System.IO;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for Inflater.
- /// </summary>
- public class Inflater
- {
- private BitStream _input;
-
- public Inflater()
- {
- }
-
- public void SetInput(byte[] input, int offset, int len)
- {
- _input = new BitStream(input, offset, len);
- }
-
- public void Inflate(byte[] output, int offset, int size)
- {
- byte cmf = (byte)_input.GetBits(8);
- byte flag = (byte)_input.GetBits(8);
-
- if ((cmf & 0x0f) != 8)
- throw new Exception("Only deflate format data is supported");
-
- if (((cmf*256+flag) % 31) != 0)
- throw new Exception("Data is not in proper deflate format");
-
-
-
- }
- }
-}
+using System;\r
+using System.IO;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for Inflater.\r
+ /// </summary>\r
+ public class Inflater\r
+ {\r
+ private BitStream _input;\r
+\r
+ public Inflater()\r
+ {\r
+ }\r
+\r
+ public void SetInput(byte[] input, int offset, int len)\r
+ {\r
+ _input = new BitStream(input, offset, len);\r
+ }\r
+\r
+ public void Inflate(byte[] output, int offset, int size)\r
+ {\r
+ byte cmf = (byte)_input.GetBits(8);\r
+ byte flag = (byte)_input.GetBits(8);\r
+\r
+ if ((cmf & 0x0f) != 8)\r
+ throw new Exception("Only deflate format data is supported");\r
+\r
+ if (((cmf*256+flag) % 31) != 0)\r
+ throw new Exception("Data is not in proper deflate format");\r
+\r
+\r
+\r
+ }\r
+ }\r
+}\r
-using System;
-using System.Net;
-using System.IO;
-using System.Collections;
-using System.Threading;
-
-namespace ByteFX.Data.Common
-{
- internal enum MultiHostStreamErrorType
- {
- Connecting,
- Reading,
- Writing
- }
-
- /// <summary>
- /// Summary description for MultiHostStream.
- /// </summary>
- internal abstract class MultiHostStream : Stream
- {
- protected Stream stream;
- protected int readTimeOut;
- protected Exception baseException;
-
- /// <summary>
- /// Constructs a new MultiHostStream object with the given parameters
- /// </summary>
- /// <param name="hostList"></param>
- /// <param name="port"></param>
- /// <param name="readTimeOut"></param>
- /// <param name="connectTimeOut"></param>
- public MultiHostStream(string hostList, int port, int readTimeOut, int connectTimeOut)
- {
- this.readTimeOut = readTimeOut;
- ProcessHosts( hostList, port, connectTimeOut );
- }
-
- protected abstract void TimeOut(MultiHostStreamErrorType error);
- protected abstract void Error(string msg);
- protected abstract bool CreateStream( IPAddress ip, string host, int port );
- protected abstract bool DataAvailable
- {
- get;
- }
-
- private void ProcessHosts( string hostList, int port, int connectTimeOut )
- {
- int startTime = Environment.TickCount;
-
- int toTicks = connectTimeOut * 1000;
- //
- // Host name can contain multiple hosts, seperated by &.
- string [] dnsHosts = hostList.Split('&');
- Hashtable ips = new Hashtable();
-
- //
- // Each host name specified may contain multiple IP addresses
- // Lets look at the DNS entries for each host name
- foreach(string h in dnsHosts)
- {
- IPHostEntry hostAddress = Dns.GetHostByName(h);
- foreach (IPAddress addr in hostAddress.AddressList)
- ips.Add( addr, hostAddress.HostName );
- }
- IPAddress[] keys = new IPAddress[ ips.Count ];
- ips.Keys.CopyTo( keys, 0 );
-
- if ((Environment.TickCount - startTime) > toTicks)
- {
- TimeOut(MultiHostStreamErrorType.Connecting);
- return;
- }
-
- // make sure they gave us at least one host
- if (ips.Count == 0)
- {
- Error("You must specify at least one host");
- return;
- }
-
- int index = 0;
- // now choose a random server if there are more than one
- if (ips.Count > 1)
- {
- System.Random random = new Random((int)DateTime.Now.Ticks);
- index = random.Next(ips.Count-1);
- }
-
- //
- // Lets step through our hosts until we get a connection
- for (int i=0; i < ips.Count; i++)
- {
- if ((Environment.TickCount - startTime) > toTicks)
- {
- TimeOut(MultiHostStreamErrorType.Connecting);
- return;
- }
- if (CreateStream( (IPAddress)keys[i], (string)ips[keys[i]], port ))
- return;
- }
- }
-
- public override int ReadByte()
- {
- int start = Environment.TickCount;
- int ticks = readTimeOut * 1000;
-
- while ((Environment.TickCount - start) < ticks)
- {
- if (DataAvailable)
- {
- int b = stream.ReadByte();
- return b;
- }
- else
- Thread.Sleep(1);
- }
-
- TimeOut(MultiHostStreamErrorType.Reading);
- return -1;
- }
-
- public override int Read(byte[] buffer, int offset, int count)
- {
- int numToRead = count;
- int start = Environment.TickCount;
- int ticks = readTimeOut * 1000;
-
- while (numToRead > 0 && (Environment.TickCount - start) < ticks)
- {
- if (DataAvailable)
- {
- int bytes_read = stream.Read( buffer, offset, numToRead);
- if (bytes_read == 0)
- return (count - numToRead);
- offset += bytes_read;
- numToRead -= bytes_read;
- }
- Thread.Sleep(1);
- }
-
- if (numToRead > 0)
- TimeOut(MultiHostStreamErrorType.Reading);
- return count;
- }
-
- public override bool CanRead
- {
- get { return stream.CanRead; }
- }
-
- public override bool CanWrite
- {
- get { return stream.CanWrite; }
- }
-
- public override bool CanSeek
- {
- get { return stream.CanSeek; }
- }
-
- public override long Length
- {
- get { return stream.Length; }
- }
-
- public override long Position
- {
- get { return stream.Position; }
- set { stream.Position = value; }
- }
-
- public override void Flush()
- {
- stream.Flush();
- }
-
- public override void SetLength(long length)
- {
- stream.SetLength( length );
- }
-
- public override void Write(byte[] buffer, int offset, int count)
- {
- stream.Write( buffer, offset, count );
- }
-
- public override long Seek( long offset, SeekOrigin origin )
- {
- return stream.Seek( offset, origin );
- }
-
- }
-}
+using System;\r
+using System.Net;\r
+using System.IO;\r
+using System.Collections;\r
+using System.Threading;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ internal enum MultiHostStreamErrorType \r
+ {\r
+ Connecting,\r
+ Reading,\r
+ Writing\r
+ }\r
+\r
+ /// <summary>\r
+ /// Summary description for MultiHostStream.\r
+ /// </summary>\r
+ internal abstract class MultiHostStream : Stream\r
+ {\r
+ protected Stream stream;\r
+ protected int readTimeOut;\r
+ protected Exception baseException;\r
+\r
+ /// <summary>\r
+ /// Constructs a new MultiHostStream object with the given parameters\r
+ /// </summary>\r
+ /// <param name="hostList"></param>\r
+ /// <param name="port"></param>\r
+ /// <param name="readTimeOut"></param>\r
+ /// <param name="connectTimeOut"></param>\r
+ public MultiHostStream(string hostList, int port, int readTimeOut, int connectTimeOut)\r
+ {\r
+ this.readTimeOut = readTimeOut;\r
+ ProcessHosts( hostList, port, connectTimeOut );\r
+ }\r
+\r
+ // abstract members\r
+ protected abstract void TimeOut(MultiHostStreamErrorType error);\r
+ protected abstract void Error(string msg);\r
+ protected abstract bool CreateStream( IPAddress ip, string host, int port );\r
+ protected abstract bool CreateStream (string fileName);\r
+ protected abstract bool DataAvailable \r
+ {\r
+ get;\r
+ }\r
+\r
+ private void ProcessHosts( string hostList, int port, int connectTimeOut )\r
+ {\r
+ int startTime = Environment.TickCount;\r
+\r
+ int toTicks = connectTimeOut * 1000;\r
+\r
+ // support Unix sockets\r
+ if (hostList.StartsWith ("/")) \r
+ {\r
+ CreateStream (hostList);\r
+ return;\r
+ } \r
+\r
+ //\r
+ // Host name can contain multiple hosts, seperated by &.\r
+ string [] dnsHosts = hostList.Split('&');\r
+ Hashtable ips = new Hashtable();\r
+\r
+ //\r
+ // Each host name specified may contain multiple IP addresses\r
+ // Lets look at the DNS entries for each host name\r
+ foreach(string h in dnsHosts)\r
+ {\r
+ IPHostEntry hostAddress = Dns.GetHostByName(h);\r
+ foreach (IPAddress addr in hostAddress.AddressList)\r
+ ips.Add( addr, hostAddress.HostName );\r
+ }\r
+ IPAddress[] keys = new IPAddress[ ips.Count ];\r
+ ips.Keys.CopyTo( keys, 0 );\r
+\r
+ if ((Environment.TickCount - startTime) > toTicks)\r
+ {\r
+ TimeOut(MultiHostStreamErrorType.Connecting);\r
+ return;\r
+ }\r
+\r
+ // make sure they gave us at least one host\r
+ if (ips.Count == 0)\r
+ {\r
+ Error("You must specify at least one host");\r
+ return;\r
+ }\r
+\r
+ int index = 0;\r
+ // now choose a random server if there are more than one\r
+ if (ips.Count > 1) \r
+ {\r
+ System.Random random = new Random((int)DateTime.Now.Ticks);\r
+ index = random.Next(ips.Count-1);\r
+ }\r
+\r
+ //\r
+ // Lets step through our hosts until we get a connection\r
+ for (int i=0; i < ips.Count; i++)\r
+ {\r
+ if ((Environment.TickCount - startTime) > toTicks) \r
+ {\r
+ TimeOut(MultiHostStreamErrorType.Connecting);\r
+ return;\r
+ }\r
+ if (CreateStream( (IPAddress)keys[i], (string)ips[keys[i]], port ))\r
+ return;\r
+ }\r
+ }\r
+\r
+ public override int ReadByte()\r
+ {\r
+ int start = Environment.TickCount;\r
+ int ticks = readTimeOut * 1000;\r
+\r
+ while ((Environment.TickCount - start) < ticks)\r
+ {\r
+ if (DataAvailable)\r
+ {\r
+ int b = stream.ReadByte();\r
+ return b;\r
+ }\r
+ else\r
+ Thread.Sleep(0);\r
+ }\r
+\r
+ TimeOut(MultiHostStreamErrorType.Reading);\r
+ return -1;\r
+ }\r
+\r
+ public override int Read(byte[] buffer, int offset, int count)\r
+ {\r
+ int numToRead = count;\r
+ int start = Environment.TickCount;\r
+ int ticks = readTimeOut * 1000;\r
+\r
+ try \r
+ {\r
+ while (numToRead > 0 && (Environment.TickCount - start) < ticks)\r
+ {\r
+ if (DataAvailable) \r
+ {\r
+ int bytes_read = stream.Read( buffer, offset, numToRead);\r
+ if (bytes_read == 0)\r
+ return (count - numToRead);\r
+ offset += bytes_read;\r
+ numToRead -= bytes_read;\r
+ }\r
+ else\r
+ Thread.Sleep(0);\r
+ }\r
+ }\r
+ catch (Exception ex)\r
+ {\r
+ Console.WriteLine(ex.Message);\r
+ }\r
+\r
+ if (numToRead > 0)\r
+ TimeOut(MultiHostStreamErrorType.Reading);\r
+ return count;\r
+ }\r
+\r
+ public override bool CanRead\r
+ {\r
+ get { return stream.CanRead; }\r
+ }\r
+\r
+ public override bool CanWrite\r
+ {\r
+ get { return stream.CanWrite; }\r
+ }\r
+\r
+ public override bool CanSeek\r
+ {\r
+ get { return stream.CanSeek; }\r
+ }\r
+\r
+ public override long Length\r
+ {\r
+ get { return stream.Length; }\r
+ }\r
+\r
+ public override long Position \r
+ {\r
+ get { return stream.Position; }\r
+ set { stream.Position = value; }\r
+ }\r
+\r
+ public override void Flush() \r
+ {\r
+ stream.Flush();\r
+ }\r
+\r
+ public override void SetLength(long length)\r
+ {\r
+ stream.SetLength( length );\r
+ }\r
+\r
+ public override void Write(byte[] buffer, int offset, int count)\r
+ {\r
+ stream.Write( buffer, offset, count );\r
+ }\r
+\r
+ public override long Seek( long offset, SeekOrigin origin )\r
+ {\r
+ return stream.Seek( offset, origin );\r
+ }\r
+\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.IO;
-using System.Runtime.InteropServices;
-
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for API.
- /// </summary>
- internal class NamedPipeStream : Stream
- {
- [DllImport("kernel32.dll", EntryPoint="CreateFile", SetLastError=true)]
- private static extern IntPtr CreateFile(String lpFileName,
- UInt32 dwDesiredAccess, UInt32 dwShareMode,
- IntPtr lpSecurityAttributes, UInt32 dwCreationDisposition,
- UInt32 dwFlagsAndAttributes,
- IntPtr hTemplateFile);
- [DllImport("kernel32.dll", EntryPoint="PeekNamedPipe", SetLastError=true)]
- private static extern bool PeekNamedPipe( IntPtr handle,
- byte[] buffer, uint nBufferSize, ref uint bytesRead,
- ref uint bytesAvail, ref uint BytesLeftThisMessage);
- [DllImport("kernel32.dll", SetLastError=true)]
- private static extern bool ReadFile( IntPtr handle,
- byte[] buffer, uint toRead, ref uint read, IntPtr lpOverLapped);
- [DllImport("kernel32.dll", SetLastError=true)]
- private static extern bool WriteFile( IntPtr handle,
- byte[] buffer, uint count, ref uint written, IntPtr lpOverlapped );
- [DllImport("kernel32.dll", SetLastError=true)]
- private static extern bool CloseHandle( IntPtr handle );
- [DllImport("kernel32.dll", SetLastError=true)]
- private static extern bool FlushFileBuffers( IntPtr handle );
-
- //Constants for dwDesiredAccess:
- private const UInt32 GENERIC_READ = 0x80000000;
- private const UInt32 GENERIC_WRITE = 0x40000000;
-
- //Constants for return value:
- private const Int32 INVALID_HANDLE_VALUE = -1;
-
- //Constants for dwFlagsAndAttributes:
- private const UInt32 FILE_FLAG_OVERLAPPED = 0x40000000;
- private const UInt32 FILE_FLAG_NO_BUFFERING = 0x20000000;
-
- //Constants for dwCreationDisposition:
- private const UInt32 OPEN_EXISTING = 3;
-
- IntPtr _handle;
- FileAccess _mode;
-
- public NamedPipeStream(string host, FileAccess mode)
- {
- _handle = IntPtr.Zero;
- Open(host, mode);
- }
-
- public void Open( string host, FileAccess mode )
- {
- _mode = mode;
- uint pipemode = 0;
-
- if ((mode & FileAccess.Read) > 0)
- pipemode |= GENERIC_READ;
- if ((mode & FileAccess.Write) > 0)
- pipemode |= GENERIC_WRITE;
- _handle = CreateFile( host, pipemode,
- 0, IntPtr.Zero, OPEN_EXISTING, 0, IntPtr.Zero );
- }
-
- public bool DataAvailable
- {
- get
- {
- uint bytesRead=0, avail=0, thismsg=0;
-
- bool result = PeekNamedPipe( _handle,
- null, 0, ref bytesRead, ref avail, ref thismsg );
- return (result == true && avail > 0);
- }
- }
-
- public override bool CanRead
- {
- get { return (_mode & FileAccess.Read) > 0; }
- }
-
- public override bool CanWrite
- {
- get { return (_mode & FileAccess.Write) > 0; }
- }
-
- public override bool CanSeek
- {
- get { throw new NotSupportedException("NamedPipeStream does not support seeking"); }
- }
-
- public override long Length
- {
- get { throw new NotSupportedException("NamedPipeStream does not support seeking"); }
- }
-
- public override long Position
- {
- get { throw new NotSupportedException("NamedPipeStream does not support seeking"); }
- set { }
- }
-
- public override void Flush()
- {
- if (_handle == IntPtr.Zero)
- throw new ObjectDisposedException("NamedPipeStream", "The stream has already been closed");
- FlushFileBuffers(_handle);
- }
-
- public override int Read(byte[] buffer, int offset, int count)
- {
- if (buffer == null)
- throw new ArgumentNullException("buffer", "The buffer to read into cannot be null");
- if (buffer.Length < (offset + count))
- throw new ArgumentException("Buffer is not large enough to hold requested data", "buffer");
- if (offset < 0)
- throw new ArgumentOutOfRangeException("offset", offset, "Offset cannot be negative");
- if (count < 0)
- throw new ArgumentOutOfRangeException("count", count, "Count cannot be negative");
- if (! CanRead)
- throw new NotSupportedException("The stream does not support reading");
- if (_handle == IntPtr.Zero)
- throw new ObjectDisposedException("NamedPipeStream", "The stream has already been closed");
-
- // first read the data into an internal buffer since ReadFile cannot read into a buf at
- // a specified offset
- uint read=0;
- byte[] buf = new Byte[count];
- ReadFile( _handle, buf, (uint)count, ref read, IntPtr.Zero );
-
- for (int x=0; x < read; x++)
- {
- buffer[offset+x] = buf[x];
- }
- return (int)read;
- }
-
- public override void Close()
- {
- CloseHandle(_handle);
- _handle = IntPtr.Zero;
- }
-
- public override void SetLength(long length)
- {
- throw new NotSupportedException("NamedPipeStream doesn't support SetLength");
- }
-
- public override void Write(byte[] buffer, int offset, int count)
- {
- if (buffer == null)
- throw new ArgumentNullException("buffer", "The buffer to write into cannot be null");
- if (buffer.Length < (offset + count))
- throw new ArgumentException("Buffer does not contain amount of requested data", "buffer");
- if (offset < 0)
- throw new ArgumentOutOfRangeException("offset", offset, "Offset cannot be negative");
- if (count < 0)
- throw new ArgumentOutOfRangeException("count", count, "Count cannot be negative");
- if (! CanWrite)
- throw new NotSupportedException("The stream does not support writing");
- if (_handle == IntPtr.Zero)
- throw new ObjectDisposedException("NamedPipeStream", "The stream has already been closed");
-
- // copy data to internal buffer to allow writing from a specified offset
- byte[] buf = new Byte[count];
- for (int x=0; x < count; x++)
- {
- buf[x] = buffer[offset+x];
- }
- uint written=0;
- bool result = WriteFile( _handle, buf, (uint)count, ref written, IntPtr.Zero );
-
- if (! result)
- throw new IOException("Writing to the stream failed");
- if (written < count)
- throw new IOException("Unable to write entire buffer to stream");
- }
-
- public override long Seek( long offset, SeekOrigin origin )
- {
- throw new NotSupportedException("NamedPipeStream doesn't support seeking");
- }
- }
-}
-
-
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.IO;\r
+using System.Runtime.InteropServices;\r
+\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for API.\r
+ /// </summary>\r
+ internal class NamedPipeStream : Stream\r
+ {\r
+ [DllImport("kernel32.dll", EntryPoint="CreateFile", SetLastError=true)]\r
+ private static extern IntPtr CreateFile(String lpFileName, \r
+ UInt32 dwDesiredAccess, UInt32 dwShareMode,\r
+ IntPtr lpSecurityAttributes, UInt32 dwCreationDisposition, \r
+ UInt32 dwFlagsAndAttributes,\r
+ IntPtr hTemplateFile);\r
+ [DllImport("kernel32.dll", EntryPoint="PeekNamedPipe", SetLastError=true)]\r
+ private static extern bool PeekNamedPipe( IntPtr handle,\r
+ byte[] buffer, uint nBufferSize, ref uint bytesRead,\r
+ ref uint bytesAvail, ref uint BytesLeftThisMessage);\r
+ [DllImport("kernel32.dll", SetLastError=true)]\r
+ private static extern bool ReadFile( IntPtr handle,\r
+ byte[] buffer, uint toRead, ref uint read, IntPtr lpOverLapped);\r
+ [DllImport("kernel32.dll", SetLastError=true)]\r
+ private static extern bool WriteFile( IntPtr handle,\r
+ byte[] buffer, uint count, ref uint written, IntPtr lpOverlapped );\r
+ [DllImport("kernel32.dll", SetLastError=true)]\r
+ private static extern bool CloseHandle( IntPtr handle );\r
+ [DllImport("kernel32.dll", SetLastError=true)]\r
+ private static extern bool FlushFileBuffers( IntPtr handle );\r
+\r
+ //Constants for dwDesiredAccess:\r
+ private const UInt32 GENERIC_READ = 0x80000000;\r
+ private const UInt32 GENERIC_WRITE = 0x40000000;\r
+\r
+ //Constants for return value:\r
+ private const Int32 INVALID_HANDLE_VALUE = -1;\r
+\r
+ //Constants for dwFlagsAndAttributes:\r
+ private const UInt32 FILE_FLAG_OVERLAPPED = 0x40000000;\r
+ private const UInt32 FILE_FLAG_NO_BUFFERING = 0x20000000;\r
+\r
+ //Constants for dwCreationDisposition:\r
+ private const UInt32 OPEN_EXISTING = 3;\r
+\r
+ IntPtr _handle;\r
+ FileAccess _mode;\r
+\r
+ public NamedPipeStream(string host, FileAccess mode)\r
+ {\r
+ _handle = IntPtr.Zero;\r
+ Open(host, mode);\r
+ }\r
+\r
+ public void Open( string host, FileAccess mode )\r
+ {\r
+ _mode = mode;\r
+ uint pipemode = 0;\r
+\r
+ if ((mode & FileAccess.Read) > 0)\r
+ pipemode |= GENERIC_READ;\r
+ if ((mode & FileAccess.Write) > 0)\r
+ pipemode |= GENERIC_WRITE;\r
+ _handle = CreateFile( host, pipemode,\r
+ 0, IntPtr.Zero, OPEN_EXISTING, 0, IntPtr.Zero );\r
+ }\r
+\r
+ public bool DataAvailable\r
+ {\r
+ get \r
+ {\r
+ uint bytesRead=0, avail=0, thismsg=0;\r
+\r
+ bool result = PeekNamedPipe( _handle, \r
+ null, 0, ref bytesRead, ref avail, ref thismsg );\r
+ return (result == true && avail > 0);\r
+ }\r
+ }\r
+\r
+ public override bool CanRead\r
+ {\r
+ get { return (_mode & FileAccess.Read) > 0; }\r
+ }\r
+\r
+ public override bool CanWrite\r
+ {\r
+ get { return (_mode & FileAccess.Write) > 0; }\r
+ }\r
+\r
+ public override bool CanSeek\r
+ {\r
+ get { throw new NotSupportedException("NamedPipeStream does not support seeking"); }\r
+ }\r
+\r
+ public override long Length\r
+ {\r
+ get { throw new NotSupportedException("NamedPipeStream does not support seeking"); }\r
+ }\r
+\r
+ public override long Position \r
+ {\r
+ get { throw new NotSupportedException("NamedPipeStream does not support seeking"); }\r
+ set { }\r
+ }\r
+\r
+ public override void Flush() \r
+ {\r
+ if (_handle == IntPtr.Zero)\r
+ throw new ObjectDisposedException("NamedPipeStream", "The stream has already been closed");\r
+ FlushFileBuffers(_handle);\r
+ }\r
+\r
+ public override int Read(byte[] buffer, int offset, int count)\r
+ {\r
+ if (buffer == null) \r
+ throw new ArgumentNullException("buffer", "The buffer to read into cannot be null");\r
+ if (buffer.Length < (offset + count))\r
+ throw new ArgumentException("Buffer is not large enough to hold requested data", "buffer");\r
+ if (offset < 0) \r
+ throw new ArgumentOutOfRangeException("offset", offset, "Offset cannot be negative");\r
+ if (count < 0)\r
+ throw new ArgumentOutOfRangeException("count", count, "Count cannot be negative");\r
+ if (! CanRead)\r
+ throw new NotSupportedException("The stream does not support reading");\r
+ if (_handle == IntPtr.Zero)\r
+ throw new ObjectDisposedException("NamedPipeStream", "The stream has already been closed");\r
+\r
+ // first read the data into an internal buffer since ReadFile cannot read into a buf at\r
+ // a specified offset\r
+ uint read=0;\r
+ byte[] buf = new Byte[count];\r
+ ReadFile( _handle, buf, (uint)count, ref read, IntPtr.Zero );\r
+ \r
+ for (int x=0; x < read; x++) \r
+ {\r
+ buffer[offset+x] = buf[x];\r
+ }\r
+ return (int)read;\r
+ }\r
+\r
+ public override void Close()\r
+ {\r
+ CloseHandle(_handle);\r
+ _handle = IntPtr.Zero;\r
+ }\r
+\r
+ public override void SetLength(long length)\r
+ {\r
+ throw new NotSupportedException("NamedPipeStream doesn't support SetLength");\r
+ }\r
+\r
+ public override void Write(byte[] buffer, int offset, int count)\r
+ {\r
+ if (buffer == null) \r
+ throw new ArgumentNullException("buffer", "The buffer to write into cannot be null");\r
+ if (buffer.Length < (offset + count))\r
+ throw new ArgumentException("Buffer does not contain amount of requested data", "buffer");\r
+ if (offset < 0) \r
+ throw new ArgumentOutOfRangeException("offset", offset, "Offset cannot be negative");\r
+ if (count < 0)\r
+ throw new ArgumentOutOfRangeException("count", count, "Count cannot be negative");\r
+ if (! CanWrite)\r
+ throw new NotSupportedException("The stream does not support writing");\r
+ if (_handle == IntPtr.Zero)\r
+ throw new ObjectDisposedException("NamedPipeStream", "The stream has already been closed");\r
+ \r
+ // copy data to internal buffer to allow writing from a specified offset\r
+ byte[] buf = new Byte[count];\r
+ for (int x=0; x < count; x++) \r
+ {\r
+ buf[x] = buffer[offset+x];\r
+ }\r
+ uint written=0;\r
+ bool result = WriteFile( _handle, buf, (uint)count, ref written, IntPtr.Zero );\r
+\r
+ if (! result)\r
+ throw new IOException("Writing to the stream failed");\r
+ if (written < count)\r
+ throw new IOException("Unable to write entire buffer to stream");\r
+ }\r
+\r
+ public override long Seek( long offset, SeekOrigin origin )\r
+ {\r
+ throw new NotSupportedException("NamedPipeStream doesn't support seeking");\r
+ }\r
+ }\r
+}\r
+\r
+\r
--- /dev/null
+using System;\r
+\r
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2004 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for Platform.\r
+ /// </summary>\r
+ internal class Platform\r
+ {\r
+ public static bool IsWindows() \r
+ {\r
+ OperatingSystem os = Environment.OSVersion;\r
+ switch (os.Platform)\r
+ {\r
+ case PlatformID.Win32NT:\r
+ case PlatformID.Win32S:\r
+ case PlatformID.Win32Windows:\r
+ case PlatformID.WinCE:\r
+ return true;\r
+ }\r
+ return false;\r
+ }\r
+ }\r
+}\r
-using System;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for Security.
- /// </summary>
- internal class Security
- {
- public Security()
- {
- }
-
- public static void ArrayCrypt( byte[] src, int srcoff, byte[] dst, int dstoff, byte[] key, int length )
- {
- int idx = 0;
-
- while ( (idx+srcoff) < src.Length && idx < length )
- {
- dst[idx+dstoff] = (byte)(src[idx+srcoff] ^ key[idx]);
- idx++;
- }
- }
- }
-}
+using System;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for Security.\r
+ /// </summary>\r
+ internal class Security\r
+ {\r
+ public Security()\r
+ {\r
+ }\r
+\r
+ public static void ArrayCrypt( byte[] src, int srcoff, byte[] dst, int dstoff, byte[] key, int length )\r
+ {\r
+ int idx = 0;\r
+\r
+ while ( (idx+srcoff) < src.Length && idx < length )\r
+ {\r
+ dst[idx+dstoff] = (byte)(src[idx+srcoff] ^ key[idx]);\r
+ idx++;\r
+ }\r
+ }\r
+ }\r
+}\r
--- /dev/null
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2004 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.IO;\r
+using System.Net;\r
+using System.Net.Sockets;\r
+using System.Collections;\r
+#if __MonoCS__ \r
+using Mono.Posix;\r
+#endif\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for StreamCreator.\r
+ /// </summary>\r
+ internal class StreamCreator\r
+ {\r
+ string hostList;\r
+ int port;\r
+ string pipeName;\r
+ int timeOut;\r
+\r
+ public StreamCreator( string hosts, int port, string pipeName)\r
+ {\r
+ hostList = hosts;\r
+ this.port = port;\r
+ this.pipeName = pipeName;\r
+ }\r
+\r
+ public Stream GetStream(int timeOut) \r
+ {\r
+ this.timeOut = timeOut;\r
+\r
+ if (hostList.StartsWith("/"))\r
+ return CreateUnixSocketStream();\r
+\r
+ string [] dnsHosts = hostList.Split('&');\r
+ ArrayList ipAddresses = new ArrayList();\r
+ ArrayList hostNames = new ArrayList();\r
+\r
+ //\r
+ // Each host name specified may contain multiple IP addresses\r
+ // Lets look at the DNS entries for each host name\r
+ foreach (string h in dnsHosts)\r
+ {\r
+ IPHostEntry hostAddress = Dns.GetHostByName(h);\r
+ foreach (IPAddress addr in hostAddress.AddressList)\r
+ {\r
+ ipAddresses.Add( addr );\r
+ hostNames.Add( hostAddress.HostName );\r
+ }\r
+ }\r
+\r
+ System.Random random = new Random((int)DateTime.Now.Ticks);\r
+ int index = random.Next(ipAddresses.Count-1);\r
+\r
+ bool usePipe = pipeName != String.Empty;\r
+ Stream stream = null;\r
+ for (int i=0; i < ipAddresses.Count; i++)\r
+ {\r
+ if (usePipe)\r
+ stream = CreateNamedPipeStream( (string)hostNames[index] );\r
+ else\r
+ stream = CreateSocketStream( (IPAddress)ipAddresses[index], port );\r
+ if (stream != null) return stream;\r
+\r
+ index++;\r
+ if (index == ipAddresses.Count) index = 0;\r
+ }\r
+\r
+ return stream;\r
+ }\r
+\r
+ private Stream CreateUnixSocketStream() \r
+ {\r
+#if __MonoCS__ && !WINDOWS\r
+\r
+ Socket socket = new Socket (AddressFamily.Unix, SocketType.Stream, ProtocolType.IP);\r
+\r
+ try\r
+ {\r
+ UnixEndPoint endPoint = new UnixEndPoint (hostList[0]);\r
+ socket.Connect (endPoint);\r
+ return new NetworkStream (socket, true);\r
+ }\r
+ catch (Exception ex)\r
+ {\r
+ return null;\r
+ }\r
+#else\r
+ throw new PlatformNotSupportedException ("Unix sockets are only supported on this platform");\r
+#endif \r
+ }\r
+\r
+ private Stream CreateNamedPipeStream( string hostname ) \r
+ {\r
+ string pipePath;\r
+ if (hostname.ToLower().Equals("localhost"))\r
+ pipePath = @"\\.\pipe\" + pipeName;\r
+ else\r
+ pipePath = String.Format(@"\\{0}\pipe\{1}", hostname.ToString(), pipeName);\r
+ return new NamedPipeStream(pipePath, FileAccess.ReadWrite);\r
+ }\r
+\r
+ private void ConnectSocketCallback( IAsyncResult iar )\r
+ {\r
+ }\r
+\r
+ private Stream CreateSocketStream( IPAddress ip, int port ) \r
+ {\r
+ Socket socket = new Socket(AddressFamily.InterNetwork, \r
+ SocketType.Stream, ProtocolType.Tcp);\r
+\r
+ try\r
+ {\r
+ //\r
+ // Lets try to connect\r
+ IPEndPoint endPoint = new IPEndPoint( ip, port);\r
+// IAsyncResult iar = socket.BeginConnect( endPoint, \r
+// new AsyncCallback(ConnectSocketCallback), socket );\r
+\r
+ socket.Connect(endPoint);\r
+ socket.SetSocketOption( SocketOptionLevel.Tcp, SocketOptionName.NoDelay, 1 );\r
+ return new NetworkStream( socket, true );\r
+ }\r
+ catch (Exception)\r
+ {\r
+ return null;\r
+ }\r
+ }\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Text;
-using System.Collections;
-using System.Collections.Specialized;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for StringUtility.
- /// </summary>
- public class StringUtility
- {
- public StringUtility()
- {
- }
-
- public static string[] Split( string src, char delimiter, params char[] quotedelims )
- {
- ArrayList strings = new ArrayList();
- StringBuilder sb = new StringBuilder();
- ArrayList ar = new ArrayList(quotedelims);
- char quote_open = Char.MinValue;
-
- foreach (char c in src)
- {
- if (c == delimiter && quote_open == Char.MinValue)
- {
- strings.Add( sb.ToString() );
- sb.Remove( 0, sb.Length );
- }
-
- else if (ar.Contains(c))
- {
- if (quote_open == Char.MinValue)
- quote_open = c;
- else if (quote_open == c)
- quote_open = Char.MinValue;
- sb.Append(c);
- }
- else
- sb.Append( c );
- }
-
- if (sb.Length > 0)
- strings.Add( sb.ToString());
-
- return (string[])strings.ToArray(typeof(string));
- }
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Text;\r
+using System.Collections;\r
+using System.Collections.Specialized;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for StringUtility.\r
+ /// </summary>\r
+ public class StringUtility\r
+ {\r
+ public StringUtility()\r
+ {\r
+ }\r
+\r
+ public static string[] Split( string src, char delimiter, params char[] quotedelims )\r
+ {\r
+ ArrayList strings = new ArrayList();\r
+ StringBuilder sb = new StringBuilder();\r
+ ArrayList ar = new ArrayList(quotedelims);\r
+ char quote_open = Char.MinValue;\r
+\r
+ foreach (char c in src) \r
+ {\r
+ if (c == delimiter && quote_open == Char.MinValue) \r
+ {\r
+ strings.Add( sb.ToString() );\r
+ sb.Remove( 0, sb.Length );\r
+ }\r
+ \r
+ else if (ar.Contains(c)) \r
+ {\r
+ if (quote_open == Char.MinValue)\r
+ quote_open = c;\r
+ else if (quote_open == c)\r
+ quote_open = Char.MinValue;\r
+ sb.Append(c);\r
+ }\r
+ else\r
+ sb.Append( c );\r
+ }\r
+\r
+ if (sb.Length > 0)\r
+ strings.Add( sb.ToString());\r
+\r
+ return (string[])strings.ToArray(typeof(string));\r
+ }\r
+ }\r
+}\r
-using System;
-
-namespace ByteFX.Data.Common
-{
- /// <summary>
- /// Summary description for Version.
- /// </summary>
- internal struct Version
- {
- private int major;
- private int minor;
- private int build;
-
- public Version( int major, int minor, int build)
- {
- this.major = major;
- this.minor = minor;
- this.build = build;
- }
-
- public static Version Parse( string versionString )
- {
- int start = 0;
- int index = versionString.IndexOf('.', start);
- if (index == -1) throw new Exception("Version string not in acceptable format");
- int major = Convert.ToInt32( versionString.Substring(start, index-start).Trim());
-
- start = index+1;
- index = versionString.IndexOf('.', start);
- if (index == -1) throw new Exception("Version string not in acceptable format");
- int minor = Convert.ToInt32( versionString.Substring(start, index-start).Trim());
-
- start = index+1;
- int i = start;
- while (i < versionString.Length && Char.IsDigit( versionString, i ))
- i++;
- int build = Convert.ToInt32( versionString.Substring(start, i-start).Trim());
-
- return new Version( major, minor, build );
- }
-
- public bool isAtLeast(int major, int minor, int build)
- {
- if (major > this.major) return false;
- if (minor > this.minor) return false;
- if (build > this.build) return false;
- return true;
- }
-
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2004 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+\r
+namespace ByteFX.Data.Common\r
+{\r
+ /// <summary>\r
+ /// Summary description for Version.\r
+ /// </summary>\r
+ internal struct DBVersion\r
+ {\r
+ private int major;\r
+ private int minor;\r
+ private int build;\r
+\r
+ public DBVersion( int major, int minor, int build)\r
+ {\r
+ this.major = major;\r
+ this.minor = minor;\r
+ this.build = build;\r
+ }\r
+\r
+ public static DBVersion Parse( string versionString )\r
+ {\r
+ int start = 0;\r
+ int index = versionString.IndexOf('.', start);\r
+ if (index == -1) throw new Exception("Version string not in acceptable format");\r
+ int major = Convert.ToInt32( versionString.Substring(start, index-start).Trim());\r
+\r
+ start = index+1;\r
+ index = versionString.IndexOf('.', start);\r
+ if (index == -1) throw new Exception("Version string not in acceptable format");\r
+ int minor = Convert.ToInt32( versionString.Substring(start, index-start).Trim());\r
+\r
+ start = index+1;\r
+ int i = start;\r
+ while (i < versionString.Length && Char.IsDigit( versionString, i ))\r
+ i++;\r
+ int build = Convert.ToInt32( versionString.Substring(start, i-start).Trim());\r
+\r
+ return new DBVersion( major, minor, build );\r
+ }\r
+\r
+ public bool isAtLeast(int major, int minor, int build)\r
+ {\r
+ if (this.major > major) return true;\r
+ if (this.major == major && this.minor > minor) return true;\r
+ if (this.major == major && this.minor == minor && this.build >= build) return true;\r
+ return false;\r
+ }\r
+\r
+ }\r
+}\r
--- /dev/null
+<VisualStudioProject>\r
+ <CSHARP\r
+ ProjectType = "Local"\r
+ ProductVersion = "7.10.3077"\r
+ SchemaVersion = "2.0"\r
+ ProjectGuid = "{5EAEFBC4-8389-4120-BAB3-9B27174F6F6F}"\r
+ >\r
+ <Build>\r
+ <Settings\r
+ ApplicationIcon = ""\r
+ AssemblyKeyContainerName = ""\r
+ AssemblyName = "ByteFX.MySqlClient"\r
+ AssemblyOriginatorKeyFile = ""\r
+ DefaultClientScript = "JScript"\r
+ DefaultHTMLPageLayout = "Grid"\r
+ DefaultTargetSchema = "IE50"\r
+ DelaySign = "false"\r
+ OutputType = "Library"\r
+ PreBuildEvent = ""\r
+ PostBuildEvent = ""\r
+ RootNamespace = "ByteFX.Data.MySqlClient"\r
+ RunPostBuildEvent = "OnBuildSuccess"\r
+ StartupObject = ""\r
+ >\r
+ <Config\r
+ Name = "Debug"\r
+ AllowUnsafeBlocks = "false"\r
+ BaseAddress = "285212672"\r
+ CheckForOverflowUnderflow = "false"\r
+ ConfigurationOverrideFile = ""\r
+ DefineConstants = "DEBUG;TRACE;WINDOWS"\r
+ DocumentationFile = "doc.xml"\r
+ DebugSymbols = "true"\r
+ FileAlignment = "4096"\r
+ IncrementalBuild = "true"\r
+ NoStdLib = "false"\r
+ NoWarn = "1591"\r
+ Optimize = "false"\r
+ OutputPath = "bin\Debug\"\r
+ RegisterForComInterop = "false"\r
+ RemoveIntegerChecks = "false"\r
+ TreatWarningsAsErrors = "false"\r
+ WarningLevel = "4"\r
+ />\r
+ <Config\r
+ Name = "Release"\r
+ AllowUnsafeBlocks = "false"\r
+ BaseAddress = "285212672"\r
+ CheckForOverflowUnderflow = "false"\r
+ ConfigurationOverrideFile = ""\r
+ DefineConstants = "TRACE;WINDOWS"\r
+ DocumentationFile = "doc.xml"\r
+ DebugSymbols = "false"\r
+ FileAlignment = "4096"\r
+ IncrementalBuild = "false"\r
+ NoStdLib = "false"\r
+ NoWarn = "1591"\r
+ Optimize = "true"\r
+ OutputPath = "bin\Release\"\r
+ RegisterForComInterop = "false"\r
+ RemoveIntegerChecks = "false"\r
+ TreatWarningsAsErrors = "false"\r
+ WarningLevel = "4"\r
+ />\r
+ </Settings>\r
+ <References>\r
+ <Reference\r
+ Name = "System"\r
+ AssemblyName = "System"\r
+ HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.dll"\r
+ />\r
+ <Reference\r
+ Name = "System.Data"\r
+ AssemblyName = "System.Data"\r
+ HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.Data.dll"\r
+ />\r
+ <Reference\r
+ Name = "System.XML"\r
+ AssemblyName = "System.Xml"\r
+ HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.0.3705\System.XML.dll"\r
+ />\r
+ <Reference\r
+ Name = "System.Design"\r
+ AssemblyName = "System.Design"\r
+ HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Design.dll"\r
+ />\r
+ <Reference\r
+ Name = "System.Drawing"\r
+ AssemblyName = "System.Drawing"\r
+ HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Drawing.dll"\r
+ />\r
+ <Reference\r
+ Name = "System.Windows.Forms"\r
+ AssemblyName = "System.Windows.Forms"\r
+ HintPath = "C:\WINDOWS\Microsoft.NET\Framework\v1.1.4322\System.Windows.Forms.dll"\r
+ />\r
+ <Reference\r
+ Name = "ICSharpCode.SharpZipLib"\r
+ AssemblyName = "ICSharpCode.SharpZipLib"\r
+ HintPath = "ICSharpCode.SharpZipLib.dll"\r
+ />\r
+ </References>\r
+ </Build>\r
+ <Files>\r
+ <Include>\r
+ <File\r
+ RelPath = "AssemblyInfo.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "ChangeLog.txt"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "internals.html"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "Common\DBConnectionString.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "Common\DBParametersEditor.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "Common\Field.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "Common\NamedPipeStream.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "Common\Platform.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "Common\Security.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "Common\StreamCreator.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "Common\Version.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\CharSetMap.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\command.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\command.resx"\r
+ DependentUpon = "command.cs"\r
+ BuildAction = "EmbeddedResource"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\CommandBuilder.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\CommandResult.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\CompressedStream.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\Connection.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\Connection.resx"\r
+ DependentUpon = "Connection.cs"\r
+ BuildAction = "EmbeddedResource"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\ConnectionInternal.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\ConnectionString.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\dataadapter.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\datareader.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\Driver.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\Exception.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\Field.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\MysqlDefs.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\MySqlError.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\MySqlHelper.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\MySqlPool.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\MySqlPoolManager.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\Packet.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\parameter.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\parameter_collection.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\todo.txt"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\transaction.cs"\r
+ SubType = "Code"\r
+ BuildAction = "Compile"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\docs\MySqlCommand.xml"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\docs\MySqlCommandBuilder.xml"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\docs\MySqlConnection.xml"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\docs\MySqlDataAdapter.xml"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\docs\MySqlDataReader.xml"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\docs\MySqlException.xml"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\docs\MySqlHelper.xml"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\docs\MySqlParameter.xml"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\docs\MySqlParameterCollection.xml"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\docs\MySqlTransaction.xml"\r
+ BuildAction = "Content"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\resources\command.bmp"\r
+ BuildAction = "EmbeddedResource"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\resources\connection.bmp"\r
+ BuildAction = "EmbeddedResource"\r
+ />\r
+ <File\r
+ RelPath = "MySqlClient\resources\dataadapter.bmp"\r
+ BuildAction = "EmbeddedResource"\r
+ />\r
+ </Include>\r
+ </Files>\r
+ </CSHARP>\r
+</VisualStudioProject>\r
+\r
- GNU LESSER GENERAL PUBLIC LICENSE
- Version 2.1, February 1999
-
- Copyright (C) 1991, 1999 Free Software Foundation, Inc.
- 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
- Everyone is permitted to copy and distribute verbatim copies
- of this license document, but changing it is not allowed.
-
-[This is the first released version of the Lesser GPL. It also counts
- as the successor of the GNU Library Public License, version 2, hence
- the version number 2.1.]
-
- Preamble
-
- The licenses for most software are designed to take away your
-freedom to share and change it. By contrast, the GNU General Public
-Licenses are intended to guarantee your freedom to share and change
-free software--to make sure the software is free for all its users.
-
- This license, the Lesser General Public License, applies to some
-specially designated software packages--typically libraries--of the
-Free Software Foundation and other authors who decide to use it. You
-can use it too, but we suggest you first think carefully about whether
-this license or the ordinary General Public License is the better
-strategy to use in any particular case, based on the explanations below.
-
- When we speak of free software, we are referring to freedom of use,
-not price. Our General Public Licenses are designed to make sure that
-you have the freedom to distribute copies of free software (and charge
-for this service if you wish); that you receive source code or can get
-it if you want it; that you can change the software and use pieces of
-it in new free programs; and that you are informed that you can do
-these things.
-
- To protect your rights, we need to make restrictions that forbid
-distributors to deny you these rights or to ask you to surrender these
-rights. These restrictions translate to certain responsibilities for
-you if you distribute copies of the library or if you modify it.
-
- For example, if you distribute copies of the library, whether gratis
-or for a fee, you must give the recipients all the rights that we gave
-you. You must make sure that they, too, receive or can get the source
-code. If you link other code with the library, you must provide
-complete object files to the recipients, so that they can relink them
-with the library after making changes to the library and recompiling
-it. And you must show them these terms so they know their rights.
-
- We protect your rights with a two-step method: (1) we copyright the
-library, and (2) we offer you this license, which gives you legal
-permission to copy, distribute and/or modify the library.
-
- To protect each distributor, we want to make it very clear that
-there is no warranty for the free library. Also, if the library is
-modified by someone else and passed on, the recipients should know
-that what they have is not the original version, so that the original
-author's reputation will not be affected by problems that might be
-introduced by others.
-\f
- Finally, software patents pose a constant threat to the existence of
-any free program. We wish to make sure that a company cannot
-effectively restrict the users of a free program by obtaining a
-restrictive license from a patent holder. Therefore, we insist that
-any patent license obtained for a version of the library must be
-consistent with the full freedom of use specified in this license.
-
- Most GNU software, including some libraries, is covered by the
-ordinary GNU General Public License. This license, the GNU Lesser
-General Public License, applies to certain designated libraries, and
-is quite different from the ordinary General Public License. We use
-this license for certain libraries in order to permit linking those
-libraries into non-free programs.
-
- When a program is linked with a library, whether statically or using
-a shared library, the combination of the two is legally speaking a
-combined work, a derivative of the original library. The ordinary
-General Public License therefore permits such linking only if the
-entire combination fits its criteria of freedom. The Lesser General
-Public License permits more lax criteria for linking other code with
-the library.
-
- We call this license the "Lesser" General Public License because it
-does Less to protect the user's freedom than the ordinary General
-Public License. It also provides other free software developers Less
-of an advantage over competing non-free programs. These disadvantages
-are the reason we use the ordinary General Public License for many
-libraries. However, the Lesser license provides advantages in certain
-special circumstances.
-
- For example, on rare occasions, there may be a special need to
-encourage the widest possible use of a certain library, so that it becomes
-a de-facto standard. To achieve this, non-free programs must be
-allowed to use the library. A more frequent case is that a free
-library does the same job as widely used non-free libraries. In this
-case, there is little to gain by limiting the free library to free
-software only, so we use the Lesser General Public License.
-
- In other cases, permission to use a particular library in non-free
-programs enables a greater number of people to use a large body of
-free software. For example, permission to use the GNU C Library in
-non-free programs enables many more people to use the whole GNU
-operating system, as well as its variant, the GNU/Linux operating
-system.
-
- Although the Lesser General Public License is Less protective of the
-users' freedom, it does ensure that the user of a program that is
-linked with the Library has the freedom and the wherewithal to run
-that program using a modified version of the Library.
-
- The precise terms and conditions for copying, distribution and
-modification follow. Pay close attention to the difference between a
-"work based on the library" and a "work that uses the library". The
-former contains code derived from the library, whereas the latter must
-be combined with the library in order to run.
-\f
- GNU LESSER GENERAL PUBLIC LICENSE
- TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
-
- 0. This License Agreement applies to any software library or other
-program which contains a notice placed by the copyright holder or
-other authorized party saying it may be distributed under the terms of
-this Lesser General Public License (also called "this License").
-Each licensee is addressed as "you".
-
- A "library" means a collection of software functions and/or data
-prepared so as to be conveniently linked with application programs
-(which use some of those functions and data) to form executables.
-
- The "Library", below, refers to any such software library or work
-which has been distributed under these terms. A "work based on the
-Library" means either the Library or any derivative work under
-copyright law: that is to say, a work containing the Library or a
-portion of it, either verbatim or with modifications and/or translated
-straightforwardly into another language. (Hereinafter, translation is
-included without limitation in the term "modification".)
-
- "Source code" for a work means the preferred form of the work for
-making modifications to it. For a library, complete source code means
-all the source code for all modules it contains, plus any associated
-interface definition files, plus the scripts used to control compilation
-and installation of the library.
-
- Activities other than copying, distribution and modification are not
-covered by this License; they are outside its scope. The act of
-running a program using the Library is not restricted, and output from
-such a program is covered only if its contents constitute a work based
-on the Library (independent of the use of the Library in a tool for
-writing it). Whether that is true depends on what the Library does
-and what the program that uses the Library does.
-
- 1. You may copy and distribute verbatim copies of the Library's
-complete source code as you receive it, in any medium, provided that
-you conspicuously and appropriately publish on each copy an
-appropriate copyright notice and disclaimer of warranty; keep intact
-all the notices that refer to this License and to the absence of any
-warranty; and distribute a copy of this License along with the
-Library.
-
- You may charge a fee for the physical act of transferring a copy,
-and you may at your option offer warranty protection in exchange for a
-fee.
-\f
- 2. You may modify your copy or copies of the Library or any portion
-of it, thus forming a work based on the Library, and copy and
-distribute such modifications or work under the terms of Section 1
-above, provided that you also meet all of these conditions:
-
- a) The modified work must itself be a software library.
-
- b) You must cause the files modified to carry prominent notices
- stating that you changed the files and the date of any change.
-
- c) You must cause the whole of the work to be licensed at no
- charge to all third parties under the terms of this License.
-
- d) If a facility in the modified Library refers to a function or a
- table of data to be supplied by an application program that uses
- the facility, other than as an argument passed when the facility
- is invoked, then you must make a good faith effort to ensure that,
- in the event an application does not supply such function or
- table, the facility still operates, and performs whatever part of
- its purpose remains meaningful.
-
- (For example, a function in a library to compute square roots has
- a purpose that is entirely well-defined independent of the
- application. Therefore, Subsection 2d requires that any
- application-supplied function or table used by this function must
- be optional: if the application does not supply it, the square
- root function must still compute square roots.)
-
-These requirements apply to the modified work as a whole. If
-identifiable sections of that work are not derived from the Library,
-and can be reasonably considered independent and separate works in
-themselves, then this License, and its terms, do not apply to those
-sections when you distribute them as separate works. But when you
-distribute the same sections as part of a whole which is a work based
-on the Library, the distribution of the whole must be on the terms of
-this License, whose permissions for other licensees extend to the
-entire whole, and thus to each and every part regardless of who wrote
-it.
-
-Thus, it is not the intent of this section to claim rights or contest
-your rights to work written entirely by you; rather, the intent is to
-exercise the right to control the distribution of derivative or
-collective works based on the Library.
-
-In addition, mere aggregation of another work not based on the Library
-with the Library (or with a work based on the Library) on a volume of
-a storage or distribution medium does not bring the other work under
-the scope of this License.
-
- 3. You may opt to apply the terms of the ordinary GNU General Public
-License instead of this License to a given copy of the Library. To do
-this, you must alter all the notices that refer to this License, so
-that they refer to the ordinary GNU General Public License, version 2,
-instead of to this License. (If a newer version than version 2 of the
-ordinary GNU General Public License has appeared, then you can specify
-that version instead if you wish.) Do not make any other change in
-these notices.
-\f
- Once this change is made in a given copy, it is irreversible for
-that copy, so the ordinary GNU General Public License applies to all
-subsequent copies and derivative works made from that copy.
-
- This option is useful when you wish to copy part of the code of
-the Library into a program that is not a library.
-
- 4. You may copy and distribute the Library (or a portion or
-derivative of it, under Section 2) in object code or executable form
-under the terms of Sections 1 and 2 above provided that you accompany
-it with the complete corresponding machine-readable source code, which
-must be distributed under the terms of Sections 1 and 2 above on a
-medium customarily used for software interchange.
-
- If distribution of object code is made by offering access to copy
-from a designated place, then offering equivalent access to copy the
-source code from the same place satisfies the requirement to
-distribute the source code, even though third parties are not
-compelled to copy the source along with the object code.
-
- 5. A program that contains no derivative of any portion of the
-Library, but is designed to work with the Library by being compiled or
-linked with it, is called a "work that uses the Library". Such a
-work, in isolation, is not a derivative work of the Library, and
-therefore falls outside the scope of this License.
-
- However, linking a "work that uses the Library" with the Library
-creates an executable that is a derivative of the Library (because it
-contains portions of the Library), rather than a "work that uses the
-library". The executable is therefore covered by this License.
-Section 6 states terms for distribution of such executables.
-
- When a "work that uses the Library" uses material from a header file
-that is part of the Library, the object code for the work may be a
-derivative work of the Library even though the source code is not.
-Whether this is true is especially significant if the work can be
-linked without the Library, or if the work is itself a library. The
-threshold for this to be true is not precisely defined by law.
-
- If such an object file uses only numerical parameters, data
-structure layouts and accessors, and small macros and small inline
-functions (ten lines or less in length), then the use of the object
-file is unrestricted, regardless of whether it is legally a derivative
-work. (Executables containing this object code plus portions of the
-Library will still fall under Section 6.)
-
- Otherwise, if the work is a derivative of the Library, you may
-distribute the object code for the work under the terms of Section 6.
-Any executables containing that work also fall under Section 6,
-whether or not they are linked directly with the Library itself.
-\f
- 6. As an exception to the Sections above, you may also combine or
-link a "work that uses the Library" with the Library to produce a
-work containing portions of the Library, and distribute that work
-under terms of your choice, provided that the terms permit
-modification of the work for the customer's own use and reverse
-engineering for debugging such modifications.
-
- You must give prominent notice with each copy of the work that the
-Library is used in it and that the Library and its use are covered by
-this License. You must supply a copy of this License. If the work
-during execution displays copyright notices, you must include the
-copyright notice for the Library among them, as well as a reference
-directing the user to the copy of this License. Also, you must do one
-of these things:
-
- a) Accompany the work with the complete corresponding
- machine-readable source code for the Library including whatever
- changes were used in the work (which must be distributed under
- Sections 1 and 2 above); and, if the work is an executable linked
- with the Library, with the complete machine-readable "work that
- uses the Library", as object code and/or source code, so that the
- user can modify the Library and then relink to produce a modified
- executable containing the modified Library. (It is understood
- that the user who changes the contents of definitions files in the
- Library will not necessarily be able to recompile the application
- to use the modified definitions.)
-
- b) Use a suitable shared library mechanism for linking with the
- Library. A suitable mechanism is one that (1) uses at run time a
- copy of the library already present on the user's computer system,
- rather than copying library functions into the executable, and (2)
- will operate properly with a modified version of the library, if
- the user installs one, as long as the modified version is
- interface-compatible with the version that the work was made with.
-
- c) Accompany the work with a written offer, valid for at
- least three years, to give the same user the materials
- specified in Subsection 6a, above, for a charge no more
- than the cost of performing this distribution.
-
- d) If distribution of the work is made by offering access to copy
- from a designated place, offer equivalent access to copy the above
- specified materials from the same place.
-
- e) Verify that the user has already received a copy of these
- materials or that you have already sent this user a copy.
-
- For an executable, the required form of the "work that uses the
-Library" must include any data and utility programs needed for
-reproducing the executable from it. However, as a special exception,
-the materials to be distributed need not include anything that is
-normally distributed (in either source or binary form) with the major
-components (compiler, kernel, and so on) of the operating system on
-which the executable runs, unless that component itself accompanies
-the executable.
-
- It may happen that this requirement contradicts the license
-restrictions of other proprietary libraries that do not normally
-accompany the operating system. Such a contradiction means you cannot
-use both them and the Library together in an executable that you
-distribute.
-\f
- 7. You may place library facilities that are a work based on the
-Library side-by-side in a single library together with other library
-facilities not covered by this License, and distribute such a combined
-library, provided that the separate distribution of the work based on
-the Library and of the other library facilities is otherwise
-permitted, and provided that you do these two things:
-
- a) Accompany the combined library with a copy of the same work
- based on the Library, uncombined with any other library
- facilities. This must be distributed under the terms of the
- Sections above.
-
- b) Give prominent notice with the combined library of the fact
- that part of it is a work based on the Library, and explaining
- where to find the accompanying uncombined form of the same work.
-
- 8. You may not copy, modify, sublicense, link with, or distribute
-the Library except as expressly provided under this License. Any
-attempt otherwise to copy, modify, sublicense, link with, or
-distribute the Library is void, and will automatically terminate your
-rights under this License. However, parties who have received copies,
-or rights, from you under this License will not have their licenses
-terminated so long as such parties remain in full compliance.
-
- 9. You are not required to accept this License, since you have not
-signed it. However, nothing else grants you permission to modify or
-distribute the Library or its derivative works. These actions are
-prohibited by law if you do not accept this License. Therefore, by
-modifying or distributing the Library (or any work based on the
-Library), you indicate your acceptance of this License to do so, and
-all its terms and conditions for copying, distributing or modifying
-the Library or works based on it.
-
- 10. Each time you redistribute the Library (or any work based on the
-Library), the recipient automatically receives a license from the
-original licensor to copy, distribute, link with or modify the Library
-subject to these terms and conditions. You may not impose any further
-restrictions on the recipients' exercise of the rights granted herein.
-You are not responsible for enforcing compliance by third parties with
-this License.
-\f
- 11. If, as a consequence of a court judgment or allegation of patent
-infringement or for any other reason (not limited to patent issues),
-conditions are imposed on you (whether by court order, agreement or
-otherwise) that contradict the conditions of this License, they do not
-excuse you from the conditions of this License. If you cannot
-distribute so as to satisfy simultaneously your obligations under this
-License and any other pertinent obligations, then as a consequence you
-may not distribute the Library at all. For example, if a patent
-license would not permit royalty-free redistribution of the Library by
-all those who receive copies directly or indirectly through you, then
-the only way you could satisfy both it and this License would be to
-refrain entirely from distribution of the Library.
-
-If any portion of this section is held invalid or unenforceable under any
-particular circumstance, the balance of the section is intended to apply,
-and the section as a whole is intended to apply in other circumstances.
-
-It is not the purpose of this section to induce you to infringe any
-patents or other property right claims or to contest validity of any
-such claims; this section has the sole purpose of protecting the
-integrity of the free software distribution system which is
-implemented by public license practices. Many people have made
-generous contributions to the wide range of software distributed
-through that system in reliance on consistent application of that
-system; it is up to the author/donor to decide if he or she is willing
-to distribute software through any other system and a licensee cannot
-impose that choice.
-
-This section is intended to make thoroughly clear what is believed to
-be a consequence of the rest of this License.
-
- 12. If the distribution and/or use of the Library is restricted in
-certain countries either by patents or by copyrighted interfaces, the
-original copyright holder who places the Library under this License may add
-an explicit geographical distribution limitation excluding those countries,
-so that distribution is permitted only in or among countries not thus
-excluded. In such case, this License incorporates the limitation as if
-written in the body of this License.
-
- 13. The Free Software Foundation may publish revised and/or new
-versions of the Lesser General Public License from time to time.
-Such new versions will be similar in spirit to the present version,
-but may differ in detail to address new problems or concerns.
-
-Each version is given a distinguishing version number. If the Library
-specifies a version number of this License which applies to it and
-"any later version", you have the option of following the terms and
-conditions either of that version or of any later version published by
-the Free Software Foundation. If the Library does not specify a
-license version number, you may choose any version ever published by
-the Free Software Foundation.
-\f
- 14. If you wish to incorporate parts of the Library into other free
-programs whose distribution conditions are incompatible with these,
-write to the author to ask for permission. For software which is
-copyrighted by the Free Software Foundation, write to the Free
-Software Foundation; we sometimes make exceptions for this. Our
-decision will be guided by the two goals of preserving the free status
-of all derivatives of our free software and of promoting the sharing
-and reuse of software generally.
-
- NO WARRANTY
-
- 15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO
-WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW.
-EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR
-OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY
-KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE
-IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
-PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE
-LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME
-THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION.
-
- 16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN
-WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY
-AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU
-FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR
-CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE
-LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING
-RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A
-FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF
-SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH
-DAMAGES.
-
- END OF TERMS AND CONDITIONS
-\f
- How to Apply These Terms to Your New Libraries
-
- If you develop a new library, and you want it to be of the greatest
-possible use to the public, we recommend making it free software that
-everyone can redistribute and change. You can do so by permitting
-redistribution under these terms (or, alternatively, under the terms of the
-ordinary General Public License).
-
- To apply these terms, attach the following notices to the library. It is
-safest to attach them to the start of each source file to most effectively
-convey the exclusion of warranty; and each file should have at least the
-"copyright" line and a pointer to where the full notice is found.
-
- <one line to give the library's name and a brief idea of what it does.>
- Copyright (C) <year> <name of author>
-
- This library is free software; you can redistribute it and/or
- modify it under the terms of the GNU Lesser General Public
- License as published by the Free Software Foundation; either
- version 2.1 of the License, or (at your option) any later version.
-
- This library is distributed in the hope that it will be useful,
- but WITHOUT ANY WARRANTY; without even the implied warranty of
- MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
- Lesser General Public License for more details.
-
- You should have received a copy of the GNU Lesser General Public
- License along with this library; if not, write to the Free Software
- Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-Also add information on how to contact you by electronic and paper mail.
-
-You should also get your employer (if you work as a programmer) or your
-school, if any, to sign a "copyright disclaimer" for the library, if
-necessary. Here is a sample; alter the names:
-
- Yoyodyne, Inc., hereby disclaims all copyright interest in the
- library `Frob' (a library for tweaking knobs) written by James Random Hacker.
-
- <signature of Ty Coon>, 1 April 1990
- Ty Coon, President of Vice
-
-That's all there is to it!
-
-
+ GNU LESSER GENERAL PUBLIC LICENSE\r
+ Version 2.1, February 1999\r
+\r
+ Copyright (C) 1991, 1999 Free Software Foundation, Inc.\r
+ 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+ Everyone is permitted to copy and distribute verbatim copies\r
+ of this license document, but changing it is not allowed.\r
+\r
+[This is the first released version of the Lesser GPL. It also counts\r
+ as the successor of the GNU Library Public License, version 2, hence\r
+ the version number 2.1.]\r
+\r
+ Preamble\r
+\r
+ The licenses for most software are designed to take away your\r
+freedom to share and change it. By contrast, the GNU General Public\r
+Licenses are intended to guarantee your freedom to share and change\r
+free software--to make sure the software is free for all its users.\r
+\r
+ This license, the Lesser General Public License, applies to some\r
+specially designated software packages--typically libraries--of the\r
+Free Software Foundation and other authors who decide to use it. You\r
+can use it too, but we suggest you first think carefully about whether\r
+this license or the ordinary General Public License is the better\r
+strategy to use in any particular case, based on the explanations below.\r
+\r
+ When we speak of free software, we are referring to freedom of use,\r
+not price. Our General Public Licenses are designed to make sure that\r
+you have the freedom to distribute copies of free software (and charge\r
+for this service if you wish); that you receive source code or can get\r
+it if you want it; that you can change the software and use pieces of\r
+it in new free programs; and that you are informed that you can do\r
+these things.\r
+\r
+ To protect your rights, we need to make restrictions that forbid\r
+distributors to deny you these rights or to ask you to surrender these\r
+rights. These restrictions translate to certain responsibilities for\r
+you if you distribute copies of the library or if you modify it.\r
+\r
+ For example, if you distribute copies of the library, whether gratis\r
+or for a fee, you must give the recipients all the rights that we gave\r
+you. You must make sure that they, too, receive or can get the source\r
+code. If you link other code with the library, you must provide\r
+complete object files to the recipients, so that they can relink them\r
+with the library after making changes to the library and recompiling\r
+it. And you must show them these terms so they know their rights.\r
+\r
+ We protect your rights with a two-step method: (1) we copyright the\r
+library, and (2) we offer you this license, which gives you legal\r
+permission to copy, distribute and/or modify the library.\r
+\r
+ To protect each distributor, we want to make it very clear that\r
+there is no warranty for the free library. Also, if the library is\r
+modified by someone else and passed on, the recipients should know\r
+that what they have is not the original version, so that the original\r
+author's reputation will not be affected by problems that might be\r
+introduced by others.\r
+\f\r
+ Finally, software patents pose a constant threat to the existence of\r
+any free program. We wish to make sure that a company cannot\r
+effectively restrict the users of a free program by obtaining a\r
+restrictive license from a patent holder. Therefore, we insist that\r
+any patent license obtained for a version of the library must be\r
+consistent with the full freedom of use specified in this license.\r
+\r
+ Most GNU software, including some libraries, is covered by the\r
+ordinary GNU General Public License. This license, the GNU Lesser\r
+General Public License, applies to certain designated libraries, and\r
+is quite different from the ordinary General Public License. We use\r
+this license for certain libraries in order to permit linking those\r
+libraries into non-free programs.\r
+\r
+ When a program is linked with a library, whether statically or using\r
+a shared library, the combination of the two is legally speaking a\r
+combined work, a derivative of the original library. The ordinary\r
+General Public License therefore permits such linking only if the\r
+entire combination fits its criteria of freedom. The Lesser General\r
+Public License permits more lax criteria for linking other code with\r
+the library.\r
+\r
+ We call this license the "Lesser" General Public License because it\r
+does Less to protect the user's freedom than the ordinary General\r
+Public License. It also provides other free software developers Less\r
+of an advantage over competing non-free programs. These disadvantages\r
+are the reason we use the ordinary General Public License for many\r
+libraries. However, the Lesser license provides advantages in certain\r
+special circumstances.\r
+\r
+ For example, on rare occasions, there may be a special need to\r
+encourage the widest possible use of a certain library, so that it becomes\r
+a de-facto standard. To achieve this, non-free programs must be\r
+allowed to use the library. A more frequent case is that a free\r
+library does the same job as widely used non-free libraries. In this\r
+case, there is little to gain by limiting the free library to free\r
+software only, so we use the Lesser General Public License.\r
+\r
+ In other cases, permission to use a particular library in non-free\r
+programs enables a greater number of people to use a large body of\r
+free software. For example, permission to use the GNU C Library in\r
+non-free programs enables many more people to use the whole GNU\r
+operating system, as well as its variant, the GNU/Linux operating\r
+system.\r
+\r
+ Although the Lesser General Public License is Less protective of the\r
+users' freedom, it does ensure that the user of a program that is\r
+linked with the Library has the freedom and the wherewithal to run\r
+that program using a modified version of the Library.\r
+\r
+ The precise terms and conditions for copying, distribution and\r
+modification follow. Pay close attention to the difference between a\r
+"work based on the library" and a "work that uses the library". The\r
+former contains code derived from the library, whereas the latter must\r
+be combined with the library in order to run.\r
+\f\r
+ GNU LESSER GENERAL PUBLIC LICENSE\r
+ TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION\r
+\r
+ 0. This License Agreement applies to any software library or other\r
+program which contains a notice placed by the copyright holder or\r
+other authorized party saying it may be distributed under the terms of\r
+this Lesser General Public License (also called "this License").\r
+Each licensee is addressed as "you".\r
+\r
+ A "library" means a collection of software functions and/or data\r
+prepared so as to be conveniently linked with application programs\r
+(which use some of those functions and data) to form executables.\r
+\r
+ The "Library", below, refers to any such software library or work\r
+which has been distributed under these terms. A "work based on the\r
+Library" means either the Library or any derivative work under\r
+copyright law: that is to say, a work containing the Library or a\r
+portion of it, either verbatim or with modifications and/or translated\r
+straightforwardly into another language. (Hereinafter, translation is\r
+included without limitation in the term "modification".)\r
+\r
+ "Source code" for a work means the preferred form of the work for\r
+making modifications to it. For a library, complete source code means\r
+all the source code for all modules it contains, plus any associated\r
+interface definition files, plus the scripts used to control compilation\r
+and installation of the library.\r
+\r
+ Activities other than copying, distribution and modification are not\r
+covered by this License; they are outside its scope. The act of\r
+running a program using the Library is not restricted, and output from\r
+such a program is covered only if its contents constitute a work based\r
+on the Library (independent of the use of the Library in a tool for\r
+writing it). Whether that is true depends on what the Library does\r
+and what the program that uses the Library does.\r
+ \r
+ 1. You may copy and distribute verbatim copies of the Library's\r
+complete source code as you receive it, in any medium, provided that\r
+you conspicuously and appropriately publish on each copy an\r
+appropriate copyright notice and disclaimer of warranty; keep intact\r
+all the notices that refer to this License and to the absence of any\r
+warranty; and distribute a copy of this License along with the\r
+Library.\r
+\r
+ You may charge a fee for the physical act of transferring a copy,\r
+and you may at your option offer warranty protection in exchange for a\r
+fee.\r
+\f\r
+ 2. You may modify your copy or copies of the Library or any portion\r
+of it, thus forming a work based on the Library, and copy and\r
+distribute such modifications or work under the terms of Section 1\r
+above, provided that you also meet all of these conditions:\r
+\r
+ a) The modified work must itself be a software library.\r
+\r
+ b) You must cause the files modified to carry prominent notices\r
+ stating that you changed the files and the date of any change.\r
+\r
+ c) You must cause the whole of the work to be licensed at no\r
+ charge to all third parties under the terms of this License.\r
+\r
+ d) If a facility in the modified Library refers to a function or a\r
+ table of data to be supplied by an application program that uses\r
+ the facility, other than as an argument passed when the facility\r
+ is invoked, then you must make a good faith effort to ensure that,\r
+ in the event an application does not supply such function or\r
+ table, the facility still operates, and performs whatever part of\r
+ its purpose remains meaningful.\r
+\r
+ (For example, a function in a library to compute square roots has\r
+ a purpose that is entirely well-defined independent of the\r
+ application. Therefore, Subsection 2d requires that any\r
+ application-supplied function or table used by this function must\r
+ be optional: if the application does not supply it, the square\r
+ root function must still compute square roots.)\r
+\r
+These requirements apply to the modified work as a whole. If\r
+identifiable sections of that work are not derived from the Library,\r
+and can be reasonably considered independent and separate works in\r
+themselves, then this License, and its terms, do not apply to those\r
+sections when you distribute them as separate works. But when you\r
+distribute the same sections as part of a whole which is a work based\r
+on the Library, the distribution of the whole must be on the terms of\r
+this License, whose permissions for other licensees extend to the\r
+entire whole, and thus to each and every part regardless of who wrote\r
+it.\r
+\r
+Thus, it is not the intent of this section to claim rights or contest\r
+your rights to work written entirely by you; rather, the intent is to\r
+exercise the right to control the distribution of derivative or\r
+collective works based on the Library.\r
+\r
+In addition, mere aggregation of another work not based on the Library\r
+with the Library (or with a work based on the Library) on a volume of\r
+a storage or distribution medium does not bring the other work under\r
+the scope of this License.\r
+\r
+ 3. You may opt to apply the terms of the ordinary GNU General Public\r
+License instead of this License to a given copy of the Library. To do\r
+this, you must alter all the notices that refer to this License, so\r
+that they refer to the ordinary GNU General Public License, version 2,\r
+instead of to this License. (If a newer version than version 2 of the\r
+ordinary GNU General Public License has appeared, then you can specify\r
+that version instead if you wish.) Do not make any other change in\r
+these notices.\r
+\f\r
+ Once this change is made in a given copy, it is irreversible for\r
+that copy, so the ordinary GNU General Public License applies to all\r
+subsequent copies and derivative works made from that copy.\r
+\r
+ This option is useful when you wish to copy part of the code of\r
+the Library into a program that is not a library.\r
+\r
+ 4. You may copy and distribute the Library (or a portion or\r
+derivative of it, under Section 2) in object code or executable form\r
+under the terms of Sections 1 and 2 above provided that you accompany\r
+it with the complete corresponding machine-readable source code, which\r
+must be distributed under the terms of Sections 1 and 2 above on a\r
+medium customarily used for software interchange.\r
+\r
+ If distribution of object code is made by offering access to copy\r
+from a designated place, then offering equivalent access to copy the\r
+source code from the same place satisfies the requirement to\r
+distribute the source code, even though third parties are not\r
+compelled to copy the source along with the object code.\r
+\r
+ 5. A program that contains no derivative of any portion of the\r
+Library, but is designed to work with the Library by being compiled or\r
+linked with it, is called a "work that uses the Library". Such a\r
+work, in isolation, is not a derivative work of the Library, and\r
+therefore falls outside the scope of this License.\r
+\r
+ However, linking a "work that uses the Library" with the Library\r
+creates an executable that is a derivative of the Library (because it\r
+contains portions of the Library), rather than a "work that uses the\r
+library". The executable is therefore covered by this License.\r
+Section 6 states terms for distribution of such executables.\r
+\r
+ When a "work that uses the Library" uses material from a header file\r
+that is part of the Library, the object code for the work may be a\r
+derivative work of the Library even though the source code is not.\r
+Whether this is true is especially significant if the work can be\r
+linked without the Library, or if the work is itself a library. The\r
+threshold for this to be true is not precisely defined by law.\r
+\r
+ If such an object file uses only numerical parameters, data\r
+structure layouts and accessors, and small macros and small inline\r
+functions (ten lines or less in length), then the use of the object\r
+file is unrestricted, regardless of whether it is legally a derivative\r
+work. (Executables containing this object code plus portions of the\r
+Library will still fall under Section 6.)\r
+\r
+ Otherwise, if the work is a derivative of the Library, you may\r
+distribute the object code for the work under the terms of Section 6.\r
+Any executables containing that work also fall under Section 6,\r
+whether or not they are linked directly with the Library itself.\r
+\f\r
+ 6. As an exception to the Sections above, you may also combine or\r
+link a "work that uses the Library" with the Library to produce a\r
+work containing portions of the Library, and distribute that work\r
+under terms of your choice, provided that the terms permit\r
+modification of the work for the customer's own use and reverse\r
+engineering for debugging such modifications.\r
+\r
+ You must give prominent notice with each copy of the work that the\r
+Library is used in it and that the Library and its use are covered by\r
+this License. You must supply a copy of this License. If the work\r
+during execution displays copyright notices, you must include the\r
+copyright notice for the Library among them, as well as a reference\r
+directing the user to the copy of this License. Also, you must do one\r
+of these things:\r
+\r
+ a) Accompany the work with the complete corresponding\r
+ machine-readable source code for the Library including whatever\r
+ changes were used in the work (which must be distributed under\r
+ Sections 1 and 2 above); and, if the work is an executable linked\r
+ with the Library, with the complete machine-readable "work that\r
+ uses the Library", as object code and/or source code, so that the\r
+ user can modify the Library and then relink to produce a modified\r
+ executable containing the modified Library. (It is understood\r
+ that the user who changes the contents of definitions files in the\r
+ Library will not necessarily be able to recompile the application\r
+ to use the modified definitions.)\r
+\r
+ b) Use a suitable shared library mechanism for linking with the\r
+ Library. A suitable mechanism is one that (1) uses at run time a\r
+ copy of the library already present on the user's computer system,\r
+ rather than copying library functions into the executable, and (2)\r
+ will operate properly with a modified version of the library, if\r
+ the user installs one, as long as the modified version is\r
+ interface-compatible with the version that the work was made with.\r
+\r
+ c) Accompany the work with a written offer, valid for at\r
+ least three years, to give the same user the materials\r
+ specified in Subsection 6a, above, for a charge no more\r
+ than the cost of performing this distribution.\r
+\r
+ d) If distribution of the work is made by offering access to copy\r
+ from a designated place, offer equivalent access to copy the above\r
+ specified materials from the same place.\r
+\r
+ e) Verify that the user has already received a copy of these\r
+ materials or that you have already sent this user a copy.\r
+\r
+ For an executable, the required form of the "work that uses the\r
+Library" must include any data and utility programs needed for\r
+reproducing the executable from it. However, as a special exception,\r
+the materials to be distributed need not include anything that is\r
+normally distributed (in either source or binary form) with the major\r
+components (compiler, kernel, and so on) of the operating system on\r
+which the executable runs, unless that component itself accompanies\r
+the executable.\r
+\r
+ It may happen that this requirement contradicts the license\r
+restrictions of other proprietary libraries that do not normally\r
+accompany the operating system. Such a contradiction means you cannot\r
+use both them and the Library together in an executable that you\r
+distribute.\r
+\f\r
+ 7. You may place library facilities that are a work based on the\r
+Library side-by-side in a single library together with other library\r
+facilities not covered by this License, and distribute such a combined\r
+library, provided that the separate distribution of the work based on\r
+the Library and of the other library facilities is otherwise\r
+permitted, and provided that you do these two things:\r
+\r
+ a) Accompany the combined library with a copy of the same work\r
+ based on the Library, uncombined with any other library\r
+ facilities. This must be distributed under the terms of the\r
+ Sections above.\r
+\r
+ b) Give prominent notice with the combined library of the fact\r
+ that part of it is a work based on the Library, and explaining\r
+ where to find the accompanying uncombined form of the same work.\r
+\r
+ 8. You may not copy, modify, sublicense, link with, or distribute\r
+the Library except as expressly provided under this License. Any\r
+attempt otherwise to copy, modify, sublicense, link with, or\r
+distribute the Library is void, and will automatically terminate your\r
+rights under this License. However, parties who have received copies,\r
+or rights, from you under this License will not have their licenses\r
+terminated so long as such parties remain in full compliance.\r
+\r
+ 9. You are not required to accept this License, since you have not\r
+signed it. However, nothing else grants you permission to modify or\r
+distribute the Library or its derivative works. These actions are\r
+prohibited by law if you do not accept this License. Therefore, by\r
+modifying or distributing the Library (or any work based on the\r
+Library), you indicate your acceptance of this License to do so, and\r
+all its terms and conditions for copying, distributing or modifying\r
+the Library or works based on it.\r
+\r
+ 10. Each time you redistribute the Library (or any work based on the\r
+Library), the recipient automatically receives a license from the\r
+original licensor to copy, distribute, link with or modify the Library\r
+subject to these terms and conditions. You may not impose any further\r
+restrictions on the recipients' exercise of the rights granted herein.\r
+You are not responsible for enforcing compliance by third parties with\r
+this License.\r
+\f\r
+ 11. If, as a consequence of a court judgment or allegation of patent\r
+infringement or for any other reason (not limited to patent issues),\r
+conditions are imposed on you (whether by court order, agreement or\r
+otherwise) that contradict the conditions of this License, they do not\r
+excuse you from the conditions of this License. If you cannot\r
+distribute so as to satisfy simultaneously your obligations under this\r
+License and any other pertinent obligations, then as a consequence you\r
+may not distribute the Library at all. For example, if a patent\r
+license would not permit royalty-free redistribution of the Library by\r
+all those who receive copies directly or indirectly through you, then\r
+the only way you could satisfy both it and this License would be to\r
+refrain entirely from distribution of the Library.\r
+\r
+If any portion of this section is held invalid or unenforceable under any\r
+particular circumstance, the balance of the section is intended to apply,\r
+and the section as a whole is intended to apply in other circumstances.\r
+\r
+It is not the purpose of this section to induce you to infringe any\r
+patents or other property right claims or to contest validity of any\r
+such claims; this section has the sole purpose of protecting the\r
+integrity of the free software distribution system which is\r
+implemented by public license practices. Many people have made\r
+generous contributions to the wide range of software distributed\r
+through that system in reliance on consistent application of that\r
+system; it is up to the author/donor to decide if he or she is willing\r
+to distribute software through any other system and a licensee cannot\r
+impose that choice.\r
+\r
+This section is intended to make thoroughly clear what is believed to\r
+be a consequence of the rest of this License.\r
+\r
+ 12. If the distribution and/or use of the Library is restricted in\r
+certain countries either by patents or by copyrighted interfaces, the\r
+original copyright holder who places the Library under this License may add\r
+an explicit geographical distribution limitation excluding those countries,\r
+so that distribution is permitted only in or among countries not thus\r
+excluded. In such case, this License incorporates the limitation as if\r
+written in the body of this License.\r
+\r
+ 13. The Free Software Foundation may publish revised and/or new\r
+versions of the Lesser General Public License from time to time.\r
+Such new versions will be similar in spirit to the present version,\r
+but may differ in detail to address new problems or concerns.\r
+\r
+Each version is given a distinguishing version number. If the Library\r
+specifies a version number of this License which applies to it and\r
+"any later version", you have the option of following the terms and\r
+conditions either of that version or of any later version published by\r
+the Free Software Foundation. If the Library does not specify a\r
+license version number, you may choose any version ever published by\r
+the Free Software Foundation.\r
+\f\r
+ 14. If you wish to incorporate parts of the Library into other free\r
+programs whose distribution conditions are incompatible with these,\r
+write to the author to ask for permission. For software which is\r
+copyrighted by the Free Software Foundation, write to the Free\r
+Software Foundation; we sometimes make exceptions for this. Our\r
+decision will be guided by the two goals of preserving the free status\r
+of all derivatives of our free software and of promoting the sharing\r
+and reuse of software generally.\r
+\r
+ NO WARRANTY\r
+\r
+ 15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO\r
+WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW.\r
+EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR\r
+OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY\r
+KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE\r
+IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR\r
+PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE\r
+LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME\r
+THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION.\r
+\r
+ 16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN\r
+WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY\r
+AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU\r
+FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR\r
+CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE\r
+LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING\r
+RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A\r
+FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF\r
+SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH\r
+DAMAGES.\r
+\r
+ END OF TERMS AND CONDITIONS\r
+\f\r
+ How to Apply These Terms to Your New Libraries\r
+\r
+ If you develop a new library, and you want it to be of the greatest\r
+possible use to the public, we recommend making it free software that\r
+everyone can redistribute and change. You can do so by permitting\r
+redistribution under these terms (or, alternatively, under the terms of the\r
+ordinary General Public License).\r
+\r
+ To apply these terms, attach the following notices to the library. It is\r
+safest to attach them to the start of each source file to most effectively\r
+convey the exclusion of warranty; and each file should have at least the\r
+"copyright" line and a pointer to where the full notice is found.\r
+\r
+ <one line to give the library's name and a brief idea of what it does.>\r
+ Copyright (C) <year> <name of author>\r
+\r
+ This library is free software; you can redistribute it and/or\r
+ modify it under the terms of the GNU Lesser General Public\r
+ License as published by the Free Software Foundation; either\r
+ version 2.1 of the License, or (at your option) any later version.\r
+\r
+ This library is distributed in the hope that it will be useful,\r
+ but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+ Lesser General Public License for more details.\r
+\r
+ You should have received a copy of the GNU Lesser General Public\r
+ License along with this library; if not, write to the Free Software\r
+ Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+Also add information on how to contact you by electronic and paper mail.\r
+\r
+You should also get your employer (if you work as a programmer) or your\r
+school, if any, to sign a "copyright disclaimer" for the library, if\r
+necessary. Here is a sample; alter the names:\r
+\r
+ Yoyodyne, Inc., hereby disclaims all copyright interest in the\r
+ library `Frob' (a library for tweaking knobs) written by James Random Hacker.\r
+\r
+ <signature of Ty Coon>, 1 April 1990\r
+ Ty Coon, President of Vice\r
+\r
+That's all there is to it!\r
+\r
+\r
-using System;
-using System.Text;
-using System.Collections;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Summary description for CharSetMap.
- /// </summary>
- internal class CharSetMap
- {
- private static Hashtable mapping;
-
- /// <summary>
- ///
- /// </summary>
- /// <param name="MySqlCharSetName"></param>
- /// <returns></returns>
- public static Encoding GetEncoding( string MySqlCharSetName )
- {
- if (mapping == null )
- InitializeMapping();
- try
- {
- int cpid = (int)mapping[ MySqlCharSetName ];
- return Encoding.GetEncoding( cpid );
- }
- catch (System.NotSupportedException)
- {
- return Encoding.GetEncoding(0);
- }
- }
-
- /// <summary>
- ///
- /// </summary>
- private static void InitializeMapping()
- {
- mapping = new Hashtable();
-
- // relatively sure about
- mapping.Add( "default", 0 );
- mapping.Add( "big5", 950 ); // Traditional Chinese
- mapping.Add( "latin1", 28591 ); // Latin alphabet #1
- mapping.Add( "utf8", 65001 );
- mapping.Add( "ucs2", 1200 );
- mapping.Add( "latin2", 28592 );
- mapping.Add( "latin4", 28594 );
- mapping.Add( "latin3", 28593 );
- mapping.Add( "latin5", 1254 );
- mapping.Add( "cp1251", 1251 ); // Russian
- mapping.Add( "win1251", 1251 );
- mapping.Add( "hebrew", 1255 ); // Hebrew
- mapping.Add( "greek", 1253 ); // Greek
- mapping.Add( "sjis", 932 ); // Shift-JIS
- mapping.Add( "gbk", 936 ); // Simplified Chinese
- mapping.Add( "cp866", 866 );
- mapping.Add( "euc_kr", 949 );
-
- // maybe, maybe not...
- mapping.Add( "win1250", 1250 ); // Central Eurpoe
- mapping.Add( "win1251ukr", 1251 );
- mapping.Add( "latin1_de", 1252 ); // Latin1 German
- mapping.Add( "german1", 1252 ); // German
- mapping.Add( "danish", 1252 ); // Danish
- mapping.Add( "dos", 437 ); // Dos
- mapping.Add( "pclatin2", 852 );
- mapping.Add( "win1250ch", 1250 );
- mapping.Add( "cp1257", 1257 );
- mapping.Add( "usa7", 646 );
- mapping.Add( "czech", 912 );
- mapping.Add( "hungarian", 912 );
- mapping.Add( "croat", 912 );
-
-/* ("gb2312", "EUC_CN");
- ("ujis", "EUC_JP");
- ("latvian", "ISO8859_13");
- ("latvian1", "ISO8859_13");
- ("estonia", "ISO8859_13");
- ("koi8_ru", "KOI8_R");
- ("tis620", "TIS620");
- ("macroman", "MacRoman");
- ("macce", "MacCentralEurope");
-*/
-
- }
- }
-}
+using System;\r
+using System.Text;\r
+using System.Collections;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Summary description for CharSetMap.\r
+ /// </summary>\r
+ internal class CharSetMap\r
+ {\r
+ private static Hashtable mapping;\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ /// <param name="MySqlCharSetName"></param>\r
+ /// <returns></returns>\r
+ public static Encoding GetEncoding( string MySqlCharSetName ) \r
+ {\r
+ if (mapping == null )\r
+ InitializeMapping();\r
+ try \r
+ {\r
+ int cpid = (int)mapping[ MySqlCharSetName ];\r
+ return Encoding.GetEncoding( cpid );\r
+ }\r
+ catch (System.NotSupportedException) \r
+ {\r
+ return Encoding.GetEncoding(0);\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ private static void InitializeMapping() \r
+ {\r
+ mapping = new Hashtable();\r
+\r
+ // relatively sure about\r
+ mapping.Add( "default", 0 );\r
+ mapping.Add( "big5", 950 ); // Traditional Chinese\r
+ mapping.Add( "latin1", 28591 ); // Latin alphabet #1\r
+ mapping.Add( "utf8", 65001 );\r
+ mapping.Add( "ucs2", 1200 );\r
+ mapping.Add( "latin2", 28592 );\r
+ mapping.Add( "latin4", 28594 );\r
+ mapping.Add( "latin3", 28593 );\r
+ mapping.Add( "latin5", 1254 );\r
+ mapping.Add( "cp1251", 1251 ); // Russian\r
+ mapping.Add( "win1251", 1251 );\r
+ mapping.Add( "hebrew", 1255 ); // Hebrew\r
+ mapping.Add( "greek", 1253 ); // Greek\r
+ mapping.Add( "sjis", 932 ); // Shift-JIS\r
+ mapping.Add( "gbk", 936 ); // Simplified Chinese\r
+ mapping.Add( "cp866", 866 );\r
+ mapping.Add( "euc_kr", 949 );\r
+\r
+ // maybe, maybe not...\r
+ mapping.Add( "win1250", 1250 ); // Central Eurpoe\r
+ mapping.Add( "win1251ukr", 1251 );\r
+ mapping.Add( "latin1_de", 1252 ); // Latin1 German\r
+ mapping.Add( "german1", 1252 ); // German\r
+ mapping.Add( "danish", 1252 ); // Danish\r
+ mapping.Add( "dos", 437 ); // Dos\r
+ mapping.Add( "pclatin2", 852 ); \r
+ mapping.Add( "win1250ch", 1250 );\r
+ mapping.Add( "cp1257", 1257 );\r
+ mapping.Add( "usa7", 646 );\r
+ mapping.Add( "czech", 912 );\r
+ mapping.Add( "hungarian", 912 );\r
+ mapping.Add( "croat", 912 );\r
+\r
+/* ("gb2312", "EUC_CN");\r
+ ("ujis", "EUC_JP");\r
+ ("latvian", "ISO8859_13");\r
+ ("latvian1", "ISO8859_13");\r
+ ("estonia", "ISO8859_13");\r
+ ("koi8_ru", "KOI8_R");\r
+ ("tis620", "TIS620");\r
+ ("macroman", "MacRoman");\r
+ ("macce", "MacCentralEurope");\r
+*/\r
+\r
+ }\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.ComponentModel;
-using System.Data;
-using System.Text;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Automatically generates single-table commands used to reconcile changes made to a DataSet with the associated MySQL database. This class cannot be inherited.
- /// </summary>
- /// <include file='docs/MySqlCommandBuilder.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>
- [ToolboxItem(false)]
- [System.ComponentModel.DesignerCategory("Code")]
- public sealed class MySqlCommandBuilder : Component
- {
- private MySqlDataAdapter _adapter;
- private string _QuotePrefix;
- private string _QuoteSuffix;
- private DataTable _schema;
- private string _tableName;
-
- private MySqlCommand _updateCmd;
- private MySqlCommand _insertCmd;
- private MySqlCommand _deleteCmd;
-
- #region Constructors
- /// <summary>
- /// Overloaded. Initializes a new instance of the SqlCommandBuilder class.
- /// </summary>
- public MySqlCommandBuilder()
- {
- }
-
- /// <summary>
- /// Overloaded. Initializes a new instance of the SqlCommandBuilder class.
- /// </summary>
- public MySqlCommandBuilder( MySqlDataAdapter adapter )
- {
- _adapter = adapter;
- _adapter.RowUpdating += new MySqlRowUpdatingEventHandler( OnRowUpdating );
- }
- #endregion
-
- #region Properties
-
- /// <summary>
- /// Gets or sets a MySqlDataAdapter object for which SQL statements are automatically generated.
- /// </summary>
- public MySqlDataAdapter DataAdapter
- {
- get { return _adapter; }
- set
- {
- if (_adapter != null)
- {
- _adapter.RowUpdating -= new MySqlRowUpdatingEventHandler( OnRowUpdating );
- }
- _adapter = value;
- }
- }
-
- /// <summary>
- /// Gets or sets the beginning character or characters to use when specifying MySql database objects (for example, tables or columns) whose names contain characters such as spaces or reserved tokens.
- /// </summary>
- public string QuotePrefix
- {
- get { return _QuotePrefix; }
- set { _QuotePrefix = value; }
- }
-
- /// <summary>
- /// Gets or sets the ending character or characters to use when specifying MySql database objects (for example, tables or columns) whose names contain characters such as spaces or reserved tokens.
- /// </summary>
- public string QuoteSuffix
- {
- get { return _QuoteSuffix; }
- set { _QuoteSuffix = value; }
- }
-
- #endregion
-
- #region Public Methods
- /// <summary>
- /// Retrieves parameter information from the stored procedure specified in the MySqlCommand and populates the Parameters collection of the specified MySqlCommand object.
- /// This method is not currently supported since stored procedures are not available in MySql.
- /// </summary>
- /// <param name="command">The MySqlCommand referencing the stored procedure from which the parameter information is to be derived. The derived parameters are added to the Parameters collection of the MySqlCommand.</param>
- /// <exception cref="InvalidOperationException">The command text is not a valid stored procedure name.</exception>
- public static void DeriveParameters(MySqlCommand command)
- {
- throw new MySqlException("DeriveParameters is not supported (due to MySql not supporting SP)");
- }
-
- /// <summary>
- /// Gets the automatically generated MySqlCommand object required to perform deletions on the database.
- /// </summary>
- /// <returns></returns>
- public MySqlCommand GetDeleteCommand()
- {
- if (_schema == null)
- GenerateSchema();
- return CreateDeleteCommand();
- }
-
- /// <summary>
- /// Gets the automatically generated MySqlCommand object required to perform insertions on the database.
- /// </summary>
- /// <returns></returns>
- public MySqlCommand GetInsertCommand()
- {
- if (_schema == null)
- GenerateSchema();
- return CreateInsertCommand();
- }
-
- /// <summary>
- /// Gets the automatically generated MySqlCommand object required to perform updates on the database.
- /// </summary>
- /// <returns></returns>
- public MySqlCommand GetUpdateCommand()
- {
- if (_schema == null)
- GenerateSchema();
- return CreateUpdateCommand();
- }
-
- /// <summary>
- /// Refreshes the database schema information used to generate INSERT, UPDATE, or DELETE statements.
- /// </summary>
- public void RefreshSchema()
- {
- _schema = null;
- _insertCmd = null;
- _deleteCmd = null;
- _updateCmd = null;
- }
- #endregion
-
- #region Private Methods
-
- private void GenerateSchema()
- {
- if (_adapter == null)
- throw new MySqlException("Improper MySqlCommandBuilder state: adapter is null");
- if (_adapter.SelectCommand == null)
- throw new MySqlException("Improper MySqlCommandBuilder state: adapter's SelectCommand is null");
-
- MySqlDataReader dr = _adapter.SelectCommand.ExecuteReader(CommandBehavior.SchemaOnly | CommandBehavior.KeyInfo);
- _schema = dr.GetSchemaTable();
- dr.Close();
-
- // make sure we got at least one unique or key field and count base table names
- bool hasKeyOrUnique=false;
-
- foreach (DataRow row in _schema.Rows)
- {
- if (true == (bool)row["IsKey"] || true == (bool)row["IsUnique"])
- hasKeyOrUnique=true;
- if (_tableName == null)
- _tableName = (string)row["BaseTableName"];
- else if (_tableName != (string)row["BaseTableName"])
- throw new InvalidOperationException("MySqlCommandBuilder does not support multi-table statements");
- }
- if (! hasKeyOrUnique)
- throw new InvalidOperationException("MySqlCommandBuilder cannot operate on tables with no unique or key columns");
- }
-
- private string Quote(string table_or_column)
- {
- if (_QuotePrefix == null || _QuoteSuffix == null)
- return table_or_column;
- return _QuotePrefix + table_or_column + _QuoteSuffix;
- }
-
- private MySqlParameter CreateParameter(DataRow row, bool Original)
- {
- MySqlParameter p;
- if (Original)
- p = new MySqlParameter( "@Original_" + (string)row["ColumnName"], (MySqlDbType)row["ProviderType"],
- ParameterDirection.Input, (string)row["ColumnName"], DataRowVersion.Original, DBNull.Value );
- else
- p = new MySqlParameter( "@" + (string)row["ColumnName"], (MySqlDbType)row["ProviderType"],
- ParameterDirection.Input, (string)row["ColumnName"], DataRowVersion.Current, DBNull.Value );
- return p;
- }
-
- private MySqlCommand CreateBaseCommand()
- {
- MySqlCommand cmd = new MySqlCommand();
- cmd.Connection = _adapter.SelectCommand.Connection;
- cmd.CommandTimeout = _adapter.SelectCommand.CommandTimeout;
- cmd.Transaction = _adapter.SelectCommand.Transaction;
- return cmd;
- }
-
- private MySqlCommand CreateDeleteCommand()
- {
- if (_deleteCmd != null) return _deleteCmd;
-
- MySqlCommand cmd = CreateBaseCommand();
-
- cmd.CommandText = "DELETE FROM " + Quote(_tableName) +
- " WHERE " + CreateOriginalWhere(cmd);
-
- _deleteCmd = cmd;
- return cmd;
- }
-
- private string CreateFinalSelect(bool forinsert)
- {
- StringBuilder sel = new StringBuilder();
- StringBuilder where = new StringBuilder();
-
- foreach (DataRow row in _schema.Rows)
- {
- string colname = (string)row["ColumnName"];
- if (sel.Length > 0)
- sel.Append(", ");
- sel.Append( colname );
- if ((bool)row["IsKey"] == false) continue;
- if (where.Length > 0)
- where.Append(" AND ");
- where.Append( "(" + colname + "=" );
- if (forinsert)
- {
- if ((bool)row["IsAutoIncrement"])
- where.Append("last_insert_id()");
- else if ((bool)row["IsKey"])
- where.Append("@" + colname);
- }
- else
- {
- where.Append("@Original_" + colname);
- }
- where.Append(")");
- }
- return "SELECT " + sel.ToString() + " FROM " + Quote(_tableName) +
- " WHERE " + where.ToString();
- }
-
- private string CreateOriginalWhere(MySqlCommand cmd)
- {
- StringBuilder wherestr = new StringBuilder();
-
- foreach (DataRow row in _schema.Rows)
- {
- if (! IncludedInWhereClause(row)) continue;
-
- // first update the where clause since it will contain all parameters
- if (wherestr.Length > 0)
- wherestr.Append(" AND ");
- string colname = Quote((string)row["ColumnName"]);
-
- MySqlParameter op = CreateParameter(row, true);
- cmd.Parameters.Add(op);
-
- wherestr.Append( "(" + colname + "=@" + op.ParameterName);
- if ((bool)row["AllowDBNull"] == true)
- wherestr.Append( " or (" + colname + " IS NULL and @" + op.ParameterName + " IS NULL)");
- wherestr.Append(")");
- }
- return wherestr.ToString();
- }
-
- private MySqlCommand CreateUpdateCommand()
- {
- if (_updateCmd != null) return _updateCmd;
-
- MySqlCommand cmd = CreateBaseCommand();
-
- StringBuilder setstr = new StringBuilder();
-
- foreach (DataRow schemaRow in _schema.Rows)
- {
- string colname = Quote((string)schemaRow["ColumnName"]);
-
- if (! IncludedInUpdate(schemaRow)) continue;
-
- if (setstr.Length > 0)
- setstr.Append(", ");
-
- MySqlParameter p = CreateParameter(schemaRow, false);
- cmd.Parameters.Add(p);
-
- setstr.Append( colname + "=@" + p.ParameterName );
- }
-
- cmd.CommandText = "UPDATE " + Quote(_tableName) + " SET " + setstr.ToString() +
- " WHERE " + CreateOriginalWhere(cmd);
- cmd.CommandText += "; " + CreateFinalSelect(false);
-
- _updateCmd = cmd;
- return cmd;
- }
-
- private MySqlCommand CreateInsertCommand()
- {
- if (_insertCmd != null) return _insertCmd;
-
- MySqlCommand cmd = CreateBaseCommand();
-
- StringBuilder setstr = new StringBuilder();
- StringBuilder valstr = new StringBuilder();
- foreach (DataRow schemaRow in _schema.Rows)
- {
- string colname = Quote((string)schemaRow["ColumnName"]);
-
- if (!IncludedInInsert(schemaRow)) continue;
-
- if (setstr.Length > 0)
- {
- setstr.Append(", ");
- valstr.Append(", ");
- }
-
- MySqlParameter p = CreateParameter(schemaRow, false);
- cmd.Parameters.Add(p);
-
- setstr.Append( colname );
- valstr.Append( "@" + p.ParameterName );
- }
-
- cmd.CommandText = "INSERT INTO " + Quote(_tableName) + " (" + setstr.ToString() + ") " +
- " VALUES (" + valstr.ToString() + ")";
- cmd.CommandText += "; " + CreateFinalSelect(true);
-
- _insertCmd = cmd;
- return cmd;
- }
-
- private bool IncludedInInsert (DataRow schemaRow)
- {
- // If the parameter has one of these properties, then we don't include it in the insert:
- // AutoIncrement, Hidden, Expression, RowVersion, ReadOnly
-
- if ((bool) schemaRow ["IsAutoIncrement"])
- return false;
-/* if ((bool) schemaRow ["IsHidden"])
- return false;
- if ((bool) schemaRow ["IsExpression"])
- return false;*/
- if ((bool) schemaRow ["IsRowVersion"])
- return false;
- if ((bool) schemaRow ["IsReadOnly"])
- return false;
- return true;
- }
-
- private bool IncludedInUpdate (DataRow schemaRow)
- {
- // If the parameter has one of these properties, then we don't include it in the insert:
- // AutoIncrement, Hidden, RowVersion
-
- if ((bool) schemaRow ["IsAutoIncrement"])
- return false;
-// if ((bool) schemaRow ["IsHidden"])
-// return false;
- if ((bool) schemaRow ["IsRowVersion"])
- return false;
- return true;
- }
-
- private bool IncludedInWhereClause (DataRow schemaRow)
- {
-// if ((bool) schemaRow ["IsLong"])
-// return false;
- return true;
- }
-
- private void SetParameterValues(MySqlCommand cmd, DataRow dataRow)
- {
- foreach (MySqlParameter p in cmd.Parameters)
- {
- if (p.ParameterName.Length >= 8 && p.ParameterName.Substring(0, 8).Equals("Original"))
- p.Value = dataRow[ p.SourceColumn, DataRowVersion.Original ];
- else
- p.Value = dataRow[ p.SourceColumn, DataRowVersion.Current ];
- }
- }
-
- private void OnRowUpdating(object sender, MySqlRowUpdatingEventArgs args)
- {
- // make sure we are still to proceed
- if (args.Status != UpdateStatus.Continue) return;
-
- if (_schema == null)
- GenerateSchema();
-
- if (StatementType.Delete == args.StatementType)
- args.Command = CreateDeleteCommand();
- else if (StatementType.Update == args.StatementType)
- args.Command = CreateUpdateCommand();
- else if (StatementType.Insert == args.StatementType)
- args.Command = CreateInsertCommand();
- else if (StatementType.Select == args.StatementType)
- return;
-
- SetParameterValues(args.Command, args.Row);
- }
- #endregion
-
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.ComponentModel;\r
+using System.Data;\r
+using System.Text;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Automatically generates single-table commands used to reconcile changes made to a DataSet with the associated MySQL database. This class cannot be inherited.\r
+ /// </summary>\r
+ /// <include file='docs/MySqlCommandBuilder.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>\r
+ [ToolboxItem(false)]\r
+ [System.ComponentModel.DesignerCategory("Code")]\r
+ public sealed class MySqlCommandBuilder : Component\r
+ {\r
+ private MySqlDataAdapter _adapter;\r
+ private string _QuotePrefix;\r
+ private string _QuoteSuffix;\r
+ private DataTable _schema;\r
+ private string _tableName;\r
+\r
+ private MySqlCommand _updateCmd;\r
+ private MySqlCommand _insertCmd;\r
+ private MySqlCommand _deleteCmd;\r
+\r
+ #region Constructors\r
+ /// <summary>\r
+ /// Overloaded. Initializes a new instance of the SqlCommandBuilder class.\r
+ /// </summary>\r
+ public MySqlCommandBuilder()\r
+ {\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overloaded. Initializes a new instance of the SqlCommandBuilder class.\r
+ /// </summary>\r
+ public MySqlCommandBuilder( MySqlDataAdapter adapter )\r
+ {\r
+ _adapter = adapter;\r
+ _adapter.RowUpdating += new MySqlRowUpdatingEventHandler( OnRowUpdating );\r
+ }\r
+ #endregion\r
+\r
+ #region Properties\r
+\r
+ /// <summary>\r
+ /// Gets or sets a MySqlDataAdapter object for which SQL statements are automatically generated.\r
+ /// </summary>\r
+ public MySqlDataAdapter DataAdapter \r
+ {\r
+ get { return _adapter; }\r
+ set \r
+ { \r
+ if (_adapter != null) \r
+ {\r
+ _adapter.RowUpdating -= new MySqlRowUpdatingEventHandler( OnRowUpdating );\r
+ }\r
+ _adapter = value; \r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the beginning character or characters to use when specifying MySql database objects (for example, tables or columns) whose names contain characters such as spaces or reserved tokens.\r
+ /// </summary>\r
+ public string QuotePrefix \r
+ {\r
+ get { return _QuotePrefix; }\r
+ set { _QuotePrefix = value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the ending character or characters to use when specifying MySql database objects (for example, tables or columns) whose names contain characters such as spaces or reserved tokens.\r
+ /// </summary>\r
+ public string QuoteSuffix\r
+ {\r
+ get { return _QuoteSuffix; }\r
+ set { _QuoteSuffix = value; }\r
+ }\r
+\r
+ #endregion\r
+\r
+ #region Public Methods\r
+ /// <summary>\r
+ /// Retrieves parameter information from the stored procedure specified in the MySqlCommand and populates the Parameters collection of the specified MySqlCommand object.\r
+ /// This method is not currently supported since stored procedures are not available in MySql.\r
+ /// </summary>\r
+ /// <param name="command">The MySqlCommand referencing the stored procedure from which the parameter information is to be derived. The derived parameters are added to the Parameters collection of the MySqlCommand.</param>\r
+ /// <exception cref="InvalidOperationException">The command text is not a valid stored procedure name.</exception>\r
+ public static void DeriveParameters(MySqlCommand command)\r
+ {\r
+ throw new MySqlException("DeriveParameters is not supported (due to MySql not supporting SP)");\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the automatically generated MySqlCommand object required to perform deletions on the database.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public MySqlCommand GetDeleteCommand()\r
+ {\r
+ if (_schema == null)\r
+ GenerateSchema();\r
+ return CreateDeleteCommand();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the automatically generated MySqlCommand object required to perform insertions on the database.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public MySqlCommand GetInsertCommand()\r
+ {\r
+ if (_schema == null)\r
+ GenerateSchema();\r
+ return CreateInsertCommand();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the automatically generated MySqlCommand object required to perform updates on the database.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public MySqlCommand GetUpdateCommand() \r
+ {\r
+ if (_schema == null)\r
+ GenerateSchema();\r
+ return CreateUpdateCommand();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Refreshes the database schema information used to generate INSERT, UPDATE, or DELETE statements.\r
+ /// </summary>\r
+ public void RefreshSchema()\r
+ {\r
+ _schema = null;\r
+ _insertCmd = null;\r
+ _deleteCmd = null;\r
+ _updateCmd = null;\r
+ }\r
+ #endregion\r
+\r
+ #region Private Methods\r
+\r
+ private void GenerateSchema()\r
+ {\r
+ if (_adapter == null)\r
+ throw new MySqlException("Improper MySqlCommandBuilder state: adapter is null");\r
+ if (_adapter.SelectCommand == null)\r
+ throw new MySqlException("Improper MySqlCommandBuilder state: adapter's SelectCommand is null");\r
+\r
+ MySqlDataReader dr = _adapter.SelectCommand.ExecuteReader(CommandBehavior.SchemaOnly | CommandBehavior.KeyInfo);\r
+ _schema = dr.GetSchemaTable();\r
+ dr.Close();\r
+\r
+ // make sure we got at least one unique or key field and count base table names\r
+ bool hasKeyOrUnique=false;\r
+\r
+ foreach (DataRow row in _schema.Rows)\r
+ {\r
+ if (true == (bool)row["IsKey"] || true == (bool)row["IsUnique"])\r
+ hasKeyOrUnique=true;\r
+ if (_tableName == null)\r
+ _tableName = (string)row["BaseTableName"];\r
+ else if (_tableName != (string)row["BaseTableName"])\r
+ throw new InvalidOperationException("MySqlCommandBuilder does not support multi-table statements");\r
+ }\r
+ if (! hasKeyOrUnique)\r
+ throw new InvalidOperationException("MySqlCommandBuilder cannot operate on tables with no unique or key columns");\r
+ }\r
+\r
+ private string Quote(string table_or_column)\r
+ {\r
+ if (_QuotePrefix == null || _QuoteSuffix == null)\r
+ return table_or_column;\r
+ return _QuotePrefix + table_or_column + _QuoteSuffix;\r
+ }\r
+\r
+ private MySqlParameter CreateParameter(DataRow row, bool Original)\r
+ {\r
+ MySqlParameter p;\r
+ if (Original)\r
+ p = new MySqlParameter( "@Original_" + (string)row["ColumnName"], (MySqlDbType)row["ProviderType"],\r
+ ParameterDirection.Input, (string)row["ColumnName"], DataRowVersion.Original, DBNull.Value );\r
+ else\r
+ p = new MySqlParameter( "@" + (string)row["ColumnName"], (MySqlDbType)row["ProviderType"],\r
+ ParameterDirection.Input, (string)row["ColumnName"], DataRowVersion.Current, DBNull.Value );\r
+ return p;\r
+ }\r
+\r
+ private MySqlCommand CreateBaseCommand()\r
+ {\r
+ MySqlCommand cmd = new MySqlCommand();\r
+ cmd.Connection = _adapter.SelectCommand.Connection;\r
+ cmd.CommandTimeout = _adapter.SelectCommand.CommandTimeout;\r
+ cmd.Transaction = _adapter.SelectCommand.Transaction;\r
+ return cmd;\r
+ }\r
+\r
+ private MySqlCommand CreateDeleteCommand()\r
+ {\r
+ if (_deleteCmd != null) return _deleteCmd;\r
+\r
+ MySqlCommand cmd = CreateBaseCommand();\r
+\r
+ cmd.CommandText = "DELETE FROM " + Quote(_tableName) + \r
+ " WHERE " + CreateOriginalWhere(cmd);\r
+\r
+ _deleteCmd = cmd;\r
+ return cmd;\r
+ }\r
+\r
+ private string CreateFinalSelect(bool forinsert)\r
+ {\r
+ StringBuilder sel = new StringBuilder();\r
+ StringBuilder where = new StringBuilder();\r
+\r
+ foreach (DataRow row in _schema.Rows)\r
+ {\r
+ string colname = (string)row["ColumnName"];\r
+ if (sel.Length > 0)\r
+ sel.Append(", ");\r
+ sel.Append( colname );\r
+ if ((bool)row["IsKey"] == false) continue;\r
+ if (where.Length > 0)\r
+ where.Append(" AND ");\r
+ where.Append( "(" + colname + "=" );\r
+ if (forinsert) \r
+ {\r
+ if ((bool)row["IsAutoIncrement"])\r
+ where.Append("last_insert_id()");\r
+ else if ((bool)row["IsKey"])\r
+ where.Append("@" + colname);\r
+ }\r
+ else \r
+ {\r
+ where.Append("@Original_" + colname);\r
+ }\r
+ where.Append(")");\r
+ }\r
+ return "SELECT " + sel.ToString() + " FROM " + Quote(_tableName) +\r
+ " WHERE " + where.ToString();\r
+ }\r
+\r
+ private string CreateOriginalWhere(MySqlCommand cmd)\r
+ {\r
+ StringBuilder wherestr = new StringBuilder();\r
+\r
+ foreach (DataRow row in _schema.Rows)\r
+ {\r
+ if (! IncludedInWhereClause(row)) continue;\r
+\r
+ // first update the where clause since it will contain all parameters\r
+ if (wherestr.Length > 0)\r
+ wherestr.Append(" AND ");\r
+ string colname = Quote((string)row["ColumnName"]);\r
+\r
+ MySqlParameter op = CreateParameter(row, true);\r
+ cmd.Parameters.Add(op);\r
+\r
+ wherestr.Append( "(" + colname + "=@" + op.ParameterName);\r
+ if ((bool)row["AllowDBNull"] == true) \r
+ wherestr.Append( " or (" + colname + " IS NULL and @" + op.ParameterName + " IS NULL)");\r
+ wherestr.Append(")");\r
+ }\r
+ return wherestr.ToString();\r
+ }\r
+\r
+ private MySqlCommand CreateUpdateCommand()\r
+ {\r
+ if (_updateCmd != null) return _updateCmd; \r
+\r
+ MySqlCommand cmd = CreateBaseCommand();\r
+\r
+ StringBuilder setstr = new StringBuilder();\r
+ \r
+ foreach (DataRow schemaRow in _schema.Rows)\r
+ {\r
+ string colname = Quote((string)schemaRow["ColumnName"]);\r
+\r
+ if (! IncludedInUpdate(schemaRow)) continue;\r
+\r
+ if (setstr.Length > 0) \r
+ setstr.Append(", ");\r
+\r
+ MySqlParameter p = CreateParameter(schemaRow, false);\r
+ cmd.Parameters.Add(p);\r
+\r
+ setstr.Append( colname + "=@" + p.ParameterName );\r
+ }\r
+\r
+ cmd.CommandText = "UPDATE " + Quote(_tableName) + " SET " + setstr.ToString() + \r
+ " WHERE " + CreateOriginalWhere(cmd);\r
+ cmd.CommandText += "; " + CreateFinalSelect(false);\r
+\r
+ _updateCmd = cmd;\r
+ return cmd;\r
+ }\r
+\r
+ private MySqlCommand CreateInsertCommand()\r
+ {\r
+ if (_insertCmd != null) return _insertCmd;\r
+\r
+ MySqlCommand cmd = CreateBaseCommand();\r
+\r
+ StringBuilder setstr = new StringBuilder();\r
+ StringBuilder valstr = new StringBuilder();\r
+ foreach (DataRow schemaRow in _schema.Rows)\r
+ {\r
+ string colname = Quote((string)schemaRow["ColumnName"]);\r
+\r
+ if (!IncludedInInsert(schemaRow)) continue;\r
+\r
+ if (setstr.Length > 0) \r
+ {\r
+ setstr.Append(", ");\r
+ valstr.Append(", ");\r
+ }\r
+\r
+ MySqlParameter p = CreateParameter(schemaRow, false);\r
+ cmd.Parameters.Add(p);\r
+\r
+ setstr.Append( colname );\r
+ valstr.Append( "@" + p.ParameterName );\r
+ }\r
+\r
+ cmd.CommandText = "INSERT INTO " + Quote(_tableName) + " (" + setstr.ToString() + ") " +\r
+ " VALUES (" + valstr.ToString() + ")";\r
+ cmd.CommandText += "; " + CreateFinalSelect(true);\r
+\r
+ _insertCmd = cmd;\r
+ return cmd;\r
+ }\r
+\r
+ private bool IncludedInInsert (DataRow schemaRow)\r
+ {\r
+ // If the parameter has one of these properties, then we don't include it in the insert:\r
+ // AutoIncrement, Hidden, Expression, RowVersion, ReadOnly\r
+\r
+ if ((bool) schemaRow ["IsAutoIncrement"])\r
+ return false;\r
+/* if ((bool) schemaRow ["IsHidden"])\r
+ return false;\r
+ if ((bool) schemaRow ["IsExpression"])\r
+ return false;*/\r
+ if ((bool) schemaRow ["IsRowVersion"])\r
+ return false;\r
+ if ((bool) schemaRow ["IsReadOnly"])\r
+ return false;\r
+ return true;\r
+ }\r
+\r
+ private bool IncludedInUpdate (DataRow schemaRow)\r
+ {\r
+ // If the parameter has one of these properties, then we don't include it in the insert:\r
+ // AutoIncrement, Hidden, RowVersion\r
+\r
+ if ((bool) schemaRow ["IsAutoIncrement"])\r
+ return false;\r
+// if ((bool) schemaRow ["IsHidden"])\r
+// return false;\r
+ if ((bool) schemaRow ["IsRowVersion"])\r
+ return false;\r
+ return true;\r
+ }\r
+\r
+ private bool IncludedInWhereClause (DataRow schemaRow)\r
+ {\r
+// if ((bool) schemaRow ["IsLong"])\r
+// return false;\r
+ return true;\r
+ }\r
+\r
+ private void SetParameterValues(MySqlCommand cmd, DataRow dataRow)\r
+ {\r
+ foreach (MySqlParameter p in cmd.Parameters)\r
+ {\r
+ if (p.ParameterName.Length >= 8 && p.ParameterName.Substring(0, 8).Equals("Original"))\r
+ p.Value = dataRow[ p.SourceColumn, DataRowVersion.Original ];\r
+ else\r
+ p.Value = dataRow[ p.SourceColumn, DataRowVersion.Current ];\r
+ }\r
+ }\r
+\r
+ private void OnRowUpdating(object sender, MySqlRowUpdatingEventArgs args)\r
+ {\r
+ // make sure we are still to proceed\r
+ if (args.Status != UpdateStatus.Continue) return;\r
+\r
+ if (_schema == null)\r
+ GenerateSchema();\r
+\r
+ if (StatementType.Delete == args.StatementType)\r
+ args.Command = CreateDeleteCommand();\r
+ else if (StatementType.Update == args.StatementType)\r
+ args.Command = CreateUpdateCommand();\r
+ else if (StatementType.Insert == args.StatementType)\r
+ args.Command = CreateInsertCommand();\r
+ else if (StatementType.Select == args.StatementType)\r
+ return;\r
+\r
+ SetParameterValues(args.Command, args.Row);\r
+ }\r
+ #endregion\r
+\r
+ }\r
+}\r
--- /dev/null
+using System;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Summary description for CommandResult.\r
+ /// </summary>\r
+ internal class CommandResult\r
+ {\r
+ private Driver driver;\r
+ private Packet packet;\r
+ private int affectedRows = -1;\r
+ private int fieldCount = -1;\r
+ private int fieldsRead = 0;\r
+ private long fieldLength = 0;\r
+ private bool readSchema = false;\r
+ private bool readRows = false;\r
+\r
+ public CommandResult(Packet p, Driver d)\r
+ {\r
+ driver = d;\r
+ packet = p;\r
+ fieldCount = (int)p.ReadLenInteger();\r
+ if (fieldCount == 0)\r
+ affectedRows =(int)p.ReadLenInteger();\r
+ }\r
+\r
+ #region Properties\r
+ public bool IsResultSet \r
+ {\r
+ get { return fieldCount > 0; }\r
+ }\r
+\r
+ public int ColumnCount \r
+ {\r
+ get { return fieldCount; }\r
+ }\r
+\r
+ public int RowsAffected\r
+ {\r
+ get { return affectedRows; }\r
+ }\r
+\r
+ #endregion\r
+\r
+ public MySqlField GetField()\r
+ {\r
+ MySqlField f = new MySqlField( driver.Encoding );\r
+ packet = driver.ReadPacket();\r
+\r
+ f.TableName = packet.ReadLenString();\r
+ f.ColumnName = packet.ReadLenString();\r
+ f.ColumnLength = (int)packet.ReadNBytes();\r
+ f.Type = (MySqlDbType)packet.ReadNBytes();\r
+ packet.ReadByte(); // this is apparently 2 -- not sure what it is for\r
+ f.Flags = (ColumnFlags)packet.ReadInteger(2); //(short)(d.ReadByte() & 0xff);\r
+ f.NumericScale = packet.ReadByte();\r
+ fieldsRead++;\r
+ return f;\r
+ }\r
+\r
+ public byte[] GetFieldBuffer()\r
+ {\r
+ return packet.GetBuffer();\r
+ }\r
+\r
+ public int GetFieldIndex()\r
+ {\r
+ return (int)packet.Position;\r
+ }\r
+\r
+ public long GetFieldLength()\r
+ {\r
+ return fieldLength;\r
+ }\r
+\r
+ public bool NextField()\r
+ {\r
+ if (fieldLength >= 0)\r
+ packet.Position += fieldLength;\r
+ if (! packet.HasMoreData) return false;\r
+ fieldLength = packet.ReadLenInteger();\r
+ fieldsRead++;\r
+ return true;\r
+ }\r
+\r
+\r
+ /// <summary>\r
+ /// Checks to see if there are any row packets coming\r
+ /// </summary>\r
+ /// <returns>True if there are row packets available, false if not</returns>\r
+ public bool CheckForRows()\r
+ {\r
+ // first read off any unread field defs\r
+ while (fieldsRead < fieldCount)\r
+ GetField();\r
+\r
+ // read off the end of schema packet\r
+ packet = driver.ReadPacket();\r
+ if ( ! packet.IsLastPacket())\r
+ throw new MySqlException("Expected end of schema packet");\r
+ readSchema = true;\r
+\r
+ packet = driver.PeekPacket();\r
+ return ! packet.IsLastPacket();\r
+ }\r
+\r
+ public bool ReadDataRow()\r
+ {\r
+ packet = driver.ReadPacket();\r
+ if (packet.IsLastPacket())\r
+ {\r
+ readRows = true;\r
+ return false;\r
+ }\r
+ fieldsRead = 0;\r
+ fieldLength = 0;\r
+ NextField();\r
+ return true;\r
+ }\r
+\r
+ public void Clear()\r
+ {\r
+ Packet p;\r
+\r
+ if (! readSchema)\r
+ {\r
+ do \r
+ {\r
+ p = driver.ReadPacket();\r
+ } while (! p.IsLastPacket());\r
+ }\r
+\r
+ if (! readRows)\r
+ do \r
+ {\r
+ p = driver.ReadPacket();\r
+ } while (! p.IsLastPacket());\r
+ }\r
+ }\r
+}\r
--- /dev/null
+using System;\r
+using System.IO;\r
+using ICSharpCode.SharpZipLib.Zip.Compression.Streams;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Summary description for CompressedStream.\r
+ /// </summary>\r
+ internal class CompressedStream : Stream\r
+ {\r
+ private Stream srcStream;\r
+ private byte[] buffer;\r
+ private int index;\r
+\r
+ public CompressedStream( Stream src )\r
+ {\r
+ srcStream = src;\r
+ index = 0;\r
+ buffer = new byte[0];\r
+ }\r
+\r
+ #region Properties\r
+ public override bool CanRead\r
+ {\r
+ get { return srcStream.CanRead; }\r
+ }\r
+\r
+ public override bool CanWrite\r
+ {\r
+ get { return srcStream.CanWrite; }\r
+ }\r
+\r
+ public override bool CanSeek\r
+ {\r
+ get { return srcStream.CanSeek; }\r
+ }\r
+\r
+ public override long Length\r
+ {\r
+ get { return srcStream.Length; }\r
+ }\r
+\r
+ public override long Position\r
+ {\r
+ get { return srcStream.Position; }\r
+ set { srcStream.Position = value; }\r
+ }\r
+ #endregion\r
+\r
+ public override void Close()\r
+ {\r
+ srcStream.Close();\r
+ base.Close ();\r
+ }\r
+\r
+ public override void Flush()\r
+ {\r
+ srcStream.Flush();\r
+ }\r
+\r
+ public override void SetLength(long value)\r
+ {\r
+ srcStream.SetLength( value );\r
+ }\r
+\r
+ public override int ReadByte()\r
+ {\r
+ EnsureData(1);\r
+\r
+ return (int)buffer[index++];\r
+ }\r
+\r
+ public override int Read(byte[] buffer, int offset, int count)\r
+ {\r
+ if (buffer == null)\r
+ throw new ArgumentNullException( "buffer", "Buffer must not be null" );\r
+ if (offset < 0 || offset >= buffer.Length)\r
+ throw new ArgumentOutOfRangeException( "Offset must be a valid position in buffer" );\r
+ if ((offset + count) > buffer.Length)\r
+ throw new ArgumentException( "Buffer is not large enough to complete operation" );\r
+\r
+ EnsureData( count );\r
+\r
+ for (int i=0; i < count; i++)\r
+ buffer[offset+i] = this.buffer[index++];\r
+\r
+ return count;\r
+ }\r
+\r
+ public override void Write(byte[] buffer, int offset, int count)\r
+ {\r
+ srcStream.Write( buffer, offset, count );\r
+ }\r
+\r
+ public override long Seek(long offset, SeekOrigin origin)\r
+ {\r
+ return srcStream.Seek( offset, origin );\r
+ }\r
+\r
+ private void ReadBuffer( Stream s, byte[] buf, int offset, int length )\r
+ {\r
+ while (length > 0)\r
+ {\r
+ int amountRead = s.Read( buf, offset, length );\r
+ if (amountRead == 0)\r
+ throw new MySqlException("Unexpected end of data encountered");\r
+ length -= amountRead;\r
+ offset += amountRead;\r
+ }\r
+ }\r
+\r
+ private void ReadNextPacket()\r
+ {\r
+ // read off the uncompressed and compressed lengths\r
+ int compressedLen = srcStream.ReadByte() + (srcStream.ReadByte() << 8) + \r
+ (srcStream.ReadByte() << 16);\r
+ byte seq = (byte)srcStream.ReadByte();\r
+ int unCompressedLen = srcStream.ReadByte() + (srcStream.ReadByte() << 8) + \r
+ (srcStream.ReadByte() << 16);\r
+\r
+ // if the data is in fact compressed, then uncompress it\r
+ byte[] unCompressedBuffer = null;\r
+ if (unCompressedLen > 0) \r
+ {\r
+ unCompressedBuffer = new byte[ unCompressedLen ];\r
+ InflaterInputStream iis = new InflaterInputStream( srcStream );\r
+ ReadBuffer( iis, unCompressedBuffer, 0, unCompressedLen );\r
+ }\r
+ else \r
+ {\r
+ unCompressedBuffer = new byte[ compressedLen ];\r
+ ReadBuffer( srcStream, unCompressedBuffer, 0, compressedLen );\r
+ }\r
+\r
+ // now join this buffer to our existing one\r
+ int left = buffer.Length - index;\r
+ byte[] newBuffer = new byte[ left + unCompressedBuffer.Length ];\r
+\r
+ int newIndex = 0;\r
+ // first copy in the rest of the original\r
+ for (int i=index; i < buffer.Length; i++)\r
+ newBuffer[newIndex++] = buffer[i];\r
+ unCompressedBuffer.CopyTo( newBuffer, newIndex );\r
+ buffer = newBuffer;\r
+ index = 0;\r
+ }\r
+\r
+ private void EnsureData( int size )\r
+ {\r
+ while ((buffer.Length - index) < size)\r
+ ReadNextPacket();\r
+ }\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Data;
-using System.Collections.Specialized;
-using System.Text;
-using System.ComponentModel;
-using System.Globalization;
-using ByteFX.Data.Common;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Represents an open connection to a MySQL Server database. This class cannot be inherited.
- /// </summary>
- /// <include file='docs/MySqlConnection.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>
- [System.Drawing.ToolboxBitmap( typeof(MySqlConnection), "Designers.connection.bmp")]
- [System.ComponentModel.DesignerCategory("Code")]
- [ToolboxItem(true)]
- public sealed class MySqlConnection : Component, IDbConnection, ICloneable
- {
- internal ConnectionState state;
- private MySqlInternalConnection internalConnection;
- private MySqlDataReader dataReader;
- private NumberFormatInfo numberFormat;
- private MySqlConnectionString settings;
-
- /// <summary>
- /// Occurs when the state of the connection changes.
- /// </summary>
- public event StateChangeEventHandler StateChange;
-
-
- /// <summary>
- /// Creates a new connection
- /// </summary>
- public MySqlConnection()
- {
- settings = new MySqlConnectionString();
- }
-
- /// <summary>
- /// Creates a new connection
- /// </summary>
- /// <param name="container"></param>
- public MySqlConnection(System.ComponentModel.IContainer container)
- {
- settings = new MySqlConnectionString();
- }
-
-
- // Have a constructor that takes a connection string.
- /// <summary>
- /// Creates a new connection using the specified connection string.
- /// </summary>
- /// <param name="connectString"></param>
- public MySqlConnection(string connectString)
- {
- settings = new MySqlConnectionString(connectString);
- }
-
- /// <summary>
- /// Gets the name of the MySQL server to which to connect.
- /// </summary>
- #region Properties
- [Browsable(true)]
- public string DataSource
- {
- get { return settings.Host; }
- }
-
- /// <summary>
- /// Gets the time to wait while trying to establish a connection before terminating the attempt and generating an error.
- /// </summary>
- /// <include file='docs/MySqlConnection.xml' path='MyDocs/MyMembers[@name="ConnectionTimeout"]/*'/>
- [Browsable(true)]
- public int ConnectionTimeout
- {
- get { return settings.ConnectTimeout; }
- }
-
- /// <summary>
- /// Gets the name of the current database or the database to be used after a connection is opened.
- /// </summary>
- [Browsable(true)]
- public string Database
- {
- get { return settings.Database; }
- }
-
- /// <summary>
- /// Indicates if this connection should use compression when communicating with the server.
- /// </summary>
- [Browsable(false)]
- public bool UseCompression
- {
- get { return settings.UseCompression; }
- }
-
- /// <summary>
- /// Gets the current state of the connection.
- /// </summary>
- [Browsable(false)]
- public ConnectionState State
- {
- get { return state; }
- }
-
- internal MySqlDataReader Reader
- {
- get { return dataReader; }
- set { dataReader = value; }
- }
-
- internal MySqlInternalConnection InternalConnection
- {
- get { return internalConnection; }
- }
-
- internal NumberFormatInfo NumberFormat
- {
- get
- {
- if (numberFormat == null)
- {
- numberFormat = new NumberFormatInfo();
- numberFormat = (NumberFormatInfo)NumberFormatInfo.InvariantInfo.Clone();
- numberFormat.NumberDecimalSeparator = ".";
- }
- return numberFormat;
- }
- }
-
- /// <summary>
- /// Gets a string containing the version of the MySQL server to which the client is connected.
- /// </summary>
- [Browsable(false)]
- public string ServerVersion
- {
- get { return internalConnection.Driver.Version; }
- }
-
- internal Encoding Encoding
- {
- get
- {
- if (internalConnection == null)
- return System.Text.Encoding.Default;
- else
- return internalConnection.Driver.Encoding;
- }
- }
-
-
- /// <summary>
- /// Gets or sets the string used to connect to a MySQL Server database.
- /// </summary>
- /// <include file='docs/MySqlConnection.xml' path='MyDocs/MyMembers[@name="ConnectionString"]/*'/>
-#if WINDOWS
- [Editor(typeof(Designers.ConnectionStringEditor), typeof(System.Drawing.Design.UITypeEditor))]
-#endif
- [Browsable(true)]
- [Category("Data")]
- public string ConnectionString
- {
- get
- {
- // Always return exactly what the user set.
- // Security-sensitive information may be removed.
- return settings.ConnectString;
- }
- set
- {
- settings.ConnectString = value;
- if (internalConnection != null)
- internalConnection.Settings = settings;
- }
- }
-
- #endregion
-
- #region Transactions
- /// <summary>
- /// Begins a database transaction.
- /// </summary>
- /// <returns></returns>
- public MySqlTransaction BeginTransaction()
- {
- if (state != ConnectionState.Open)
- throw new MySqlException("Invalid operation: The connection is closed");
-
- MySqlTransaction t = new MySqlTransaction();
- t.Connection = this;
- InternalConnection.Driver.SendCommand( DBCmd.QUERY, "BEGIN");
- return t;
- }
-
- /// <summary>
- ///
- /// </summary>
- IDbTransaction IDbConnection.BeginTransaction()
- {
- return BeginTransaction();
- }
-
- /// <summary>
- ///
- /// </summary>
- /// <param name="level"></param>
- /// <returns></returns>
- public MySqlTransaction BeginTransaction(IsolationLevel level)
- {
- if (state != ConnectionState.Open)
- throw new MySqlException("Invalid operation: The connection is closed");
-
- MySqlTransaction t = new MySqlTransaction();
- t.Connection = this;
- t.IsolationLevel = level;
- string cmd = "SET SESSION TRANSACTION ISOLATION LEVEL ";
- switch (level)
- {
- case IsolationLevel.ReadCommitted:
- cmd += "READ COMMITTED"; break;
- case IsolationLevel.ReadUncommitted:
- cmd += "READ UNCOMMITTED"; break;
- case IsolationLevel.RepeatableRead:
- cmd += "REPEATABLE READ"; break;
- case IsolationLevel.Serializable:
- cmd += "SERIALIZABLE"; break;
- case IsolationLevel.Chaos:
- throw new NotSupportedException("Chaos isolation level is not supported");
- }
- InternalConnection.Driver.SendCommand( DBCmd.QUERY, cmd );
- InternalConnection.Driver.SendCommand( DBCmd.QUERY, "BEGIN");
- return t;
- }
-
- /// <summary>
- ///
- /// </summary>
- /// <param name="level"></param>
- /// <returns></returns>
- IDbTransaction IDbConnection.BeginTransaction(IsolationLevel level)
- {
- return BeginTransaction(level);
- }
- #endregion
-
- /// <summary>
- /// Changes the current database for an open MySqlConnection.
- /// </summary>
- /// <param name="dbName"></param>
- public void ChangeDatabase(string dbName)
- {
- if (state != ConnectionState.Open)
- throw new MySqlException("Invalid operation: The connection is closed");
-
- //TODOinternalConnection.ChangeDatabase( dbName );
- InternalConnection.Driver.SendCommand( DBCmd.INIT_DB, dbName );
- }
-
- internal void SetState( ConnectionState newState )
- {
- ConnectionState oldState = state;
- state = newState;
- if (this.StateChange != null)
- StateChange(this, new StateChangeEventArgs( oldState, newState ));
- }
-
- /// <summary>
- /// Opens a database connection with the property settings specified by the ConnectionString.
- /// </summary>
- public void Open()
- {
- if (state == ConnectionState.Open)
- throw new MySqlException("error connecting: The connection is already Open (state=Open).");
-
- SetState( ConnectionState.Connecting );
-
- if (settings.Pooling)
- {
- internalConnection = MySqlPoolManager.GetConnection( settings );
- }
- else
- {
- internalConnection = new MySqlInternalConnection( settings );
- internalConnection.Open();
- }
-
- SetState( ConnectionState.Open );
- internalConnection.SetServerVariables(this);
- ChangeDatabase( settings.Database );
- }
-
-
- /// <summary>
- /// Closes the connection to the database. This is the preferred method of closing any open connection.
- /// </summary>
- public void Close()
- {
- if (state == ConnectionState.Closed) return;
-
- if (dataReader != null)
- dataReader.Close();
-
- if (settings.Pooling)
- MySqlPoolManager.ReleaseConnection( internalConnection );
- else
- internalConnection.Close();
-
- SetState( ConnectionState.Closed );
- }
-
- IDbCommand IDbConnection.CreateCommand()
- {
- return CreateCommand();
- }
-
- /// <summary>
- /// Creates and returns a MySqlCommand object associated with the MySqlConnection.
- /// </summary>
- /// <returns></returns>
- public MySqlCommand CreateCommand()
- {
- // Return a new instance of a command object.
- MySqlCommand c = new MySqlCommand();
- c.Connection = this;
- return c;
- }
-
- #region ICloneable
- /// <summary>
- /// Creates a new MySqlConnection object with the exact same ConnectionString value
- /// </summary>
- /// <returns>A cloned MySqlConnection object</returns>
- object ICloneable.Clone()
- {
- MySqlConnection clone = new MySqlConnection();
- clone.ConnectionString = this.ConnectionString;
- //TODO: how deep should this go?
- return clone;
- }
- #endregion
-
- #region IDisposeable
- /// <summary>
- /// Releases the resources used by the MySqlConnection.
- /// </summary>
- public new void Dispose()
- {
- if (State == ConnectionState.Open)
- Close();
- base.Dispose();
- }
- #endregion
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Data;\r
+using System.Collections.Specialized;\r
+using System.Text;\r
+using System.ComponentModel;\r
+using System.Globalization;\r
+using ByteFX.Data.Common;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Represents an open connection to a MySQL Server database. This class cannot be inherited.\r
+ /// </summary>\r
+ /// <include file='docs/MySqlConnection.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>\r
+ [System.Drawing.ToolboxBitmap( typeof(MySqlConnection), "MySqlClient.resources.connection.bmp")]\r
+ [System.ComponentModel.DesignerCategory("Code")]\r
+ [ToolboxItem(true)]\r
+ public sealed class MySqlConnection : Component, IDbConnection, ICloneable\r
+ {\r
+ internal ConnectionState state;\r
+ private MySqlInternalConnection internalConnection;\r
+ private MySqlDataReader dataReader;\r
+ private NumberFormatInfo numberFormat;\r
+ private MySqlConnectionString settings;\r
+\r
+ /// <summary>\r
+ /// Occurs when the state of the connection changes.\r
+ /// </summary>\r
+ public event StateChangeEventHandler StateChange;\r
+\r
+\r
+ /// <summary>\r
+ /// Creates a new connection\r
+ /// </summary>\r
+ public MySqlConnection()\r
+ {\r
+ settings = new MySqlConnectionString("server=localhost");\r
+ }\r
+\r
+ /// <summary>\r
+ /// Creates a new connection\r
+ /// </summary>\r
+ /// <param name="container"></param>\r
+ public MySqlConnection(System.ComponentModel.IContainer container)\r
+ {\r
+ settings = new MySqlConnectionString();\r
+ }\r
+ \r
+\r
+ // Have a constructor that takes a connection string.\r
+ /// <summary>\r
+ /// Creates a new connection using the specified connection string.\r
+ /// </summary>\r
+ /// <param name="connectString"></param>\r
+ public MySqlConnection(string connectString)\r
+ {\r
+ settings = new MySqlConnectionString(connectString);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the name of the MySQL server to which to connect.\r
+ /// </summary>\r
+ #region Properties\r
+ [Browsable(true)]\r
+ public string DataSource\r
+ {\r
+ get { return settings.Server; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the time to wait while trying to establish a connection before terminating the attempt and generating an error.\r
+ /// </summary>\r
+ /// <include file='docs/MySqlConnection.xml' path='MyDocs/MyMembers[@name="ConnectionTimeout"]/*'/>\r
+ [Browsable(true)]\r
+ public int ConnectionTimeout\r
+ {\r
+ get { return settings.ConnectionTimeout; }\r
+ }\r
+ \r
+ /// <summary>\r
+ /// Gets the name of the current database or the database to be used after a connection is opened.\r
+ /// </summary>\r
+ [Browsable(true)]\r
+ public string Database\r
+ {\r
+ get { return settings.Database; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Indicates if this connection should use compression when communicating with the server.\r
+ /// </summary>\r
+ [Browsable(false)]\r
+ public bool UseCompression\r
+ {\r
+ get { return settings.UseCompression; }\r
+ }\r
+ \r
+ /// <summary>\r
+ /// Gets the current state of the connection.\r
+ /// </summary>\r
+ [Browsable(false)]\r
+ public ConnectionState State\r
+ {\r
+ get { return state; }\r
+ }\r
+\r
+ internal MySqlDataReader Reader\r
+ {\r
+ get { return dataReader; }\r
+ set { dataReader = value; }\r
+ }\r
+\r
+ internal MySqlInternalConnection InternalConnection\r
+ {\r
+ get { return internalConnection; }\r
+ }\r
+\r
+ internal NumberFormatInfo NumberFormat\r
+ {\r
+ get \r
+ {\r
+ if (numberFormat == null)\r
+ {\r
+ numberFormat = new NumberFormatInfo();\r
+ numberFormat = (NumberFormatInfo)NumberFormatInfo.InvariantInfo.Clone();\r
+ numberFormat.NumberDecimalSeparator = ".";\r
+ }\r
+ return numberFormat;\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets a string containing the version of the MySQL server to which the client is connected.\r
+ /// </summary>\r
+ [Browsable(false)]\r
+ public string ServerVersion \r
+ {\r
+ get { return internalConnection.Driver.VersionString; }\r
+ }\r
+\r
+ internal Encoding Encoding \r
+ {\r
+ get \r
+ {\r
+ if (internalConnection == null)\r
+ return System.Text.Encoding.Default;\r
+ else \r
+ return internalConnection.Driver.Encoding;\r
+ }\r
+ }\r
+\r
+\r
+ /// <summary>\r
+ /// Gets or sets the string used to connect to a MySQL Server database.\r
+ /// </summary>\r
+ /// <include file='docs/MySqlConnection.xml' path='MyDocs/MyMembers[@name="ConnectionString"]/*'/>\r
+#if WINDOWS\r
+ [Editor("ByteFX.Data.MySqlClient.Design.ConnectionStringTypeEditor,MySqlClient.Design", typeof(System.Drawing.Design.UITypeEditor))]\r
+#endif\r
+ [Browsable(true)]\r
+ [Category("Data")]\r
+ [Description("Information used to connect to a DataSource, such as 'Server=xxx;UserId=yyy;Password=zzz;Database=dbdb'.")]\r
+ public string ConnectionString\r
+ {\r
+ get\r
+ {\r
+ // Always return exactly what the user set.\r
+ // Security-sensitive information may be removed.\r
+ return settings.GetConnectionString();\r
+ }\r
+ set\r
+ {\r
+ if (this.State != ConnectionState.Closed)\r
+ throw new MySqlException("Not allowed to change the 'ConnectionString' property while the connection (state=" + State + ").");\r
+\r
+ settings.SetConnectionString(value);\r
+ if (internalConnection != null)\r
+ internalConnection.Settings = settings;\r
+ }\r
+ }\r
+\r
+ #endregion\r
+\r
+ #region Transactions\r
+ /// <summary>\r
+ /// Begins a database transaction.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public MySqlTransaction BeginTransaction()\r
+ {\r
+ if (state != ConnectionState.Open)\r
+ throw new MySqlException("Invalid operation: The connection is closed");\r
+\r
+ MySqlTransaction t = new MySqlTransaction();\r
+ t.Connection = this;\r
+ InternalConnection.Driver.Send( DBCmd.QUERY, "BEGIN");\r
+ return t;\r
+ }\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ IDbTransaction IDbConnection.BeginTransaction()\r
+ {\r
+ return BeginTransaction();\r
+ }\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ /// <param name="level"></param>\r
+ /// <returns></returns>\r
+ public MySqlTransaction BeginTransaction(IsolationLevel level)\r
+ {\r
+ if (state != ConnectionState.Open)\r
+ throw new MySqlException("Invalid operation: The connection is closed");\r
+\r
+ MySqlTransaction t = new MySqlTransaction();\r
+ t.Connection = this;\r
+ t.IsolationLevel = level;\r
+ string cmd = "SET SESSION TRANSACTION ISOLATION LEVEL ";\r
+ switch (level) \r
+ {\r
+ case IsolationLevel.ReadCommitted:\r
+ cmd += "READ COMMITTED"; break;\r
+ case IsolationLevel.ReadUncommitted:\r
+ cmd += "READ UNCOMMITTED"; break;\r
+ case IsolationLevel.RepeatableRead:\r
+ cmd += "REPEATABLE READ"; break;\r
+ case IsolationLevel.Serializable:\r
+ cmd += "SERIALIZABLE"; break;\r
+ case IsolationLevel.Chaos:\r
+ throw new NotSupportedException("Chaos isolation level is not supported");\r
+ }\r
+ InternalConnection.Driver.Send( DBCmd.QUERY, cmd );\r
+ InternalConnection.Driver.Send( DBCmd.QUERY, "BEGIN");\r
+ return t;\r
+ }\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ /// <param name="level"></param>\r
+ /// <returns></returns>\r
+ IDbTransaction IDbConnection.BeginTransaction(IsolationLevel level)\r
+ {\r
+ return BeginTransaction(level);\r
+ }\r
+ #endregion\r
+\r
+ /// <summary>\r
+ /// Changes the current database for an open MySqlConnection.\r
+ /// </summary>\r
+ /// <param name="dbName"></param>\r
+ public void ChangeDatabase(string dbName)\r
+ {\r
+ if (state != ConnectionState.Open)\r
+ throw new MySqlException("Invalid operation: The connection is closed");\r
+\r
+ //TODOinternalConnection.ChangeDatabase( dbName );\r
+ InternalConnection.Driver.Send( DBCmd.INIT_DB, dbName );\r
+ }\r
+\r
+ internal void SetState( ConnectionState newState ) \r
+ {\r
+ ConnectionState oldState = state;\r
+ state = newState;\r
+ if (this.StateChange != null)\r
+ StateChange(this, new StateChangeEventArgs( oldState, newState ));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Opens a database connection with the property settings specified by the ConnectionString.\r
+ /// </summary>\r
+ public void Open()\r
+ {\r
+ if (state == ConnectionState.Open)\r
+ throw new MySqlException("error connecting: The connection is already Open (state=Open).");\r
+\r
+ SetState( ConnectionState.Connecting );\r
+\r
+ try \r
+ {\r
+ if (settings.Pooling) \r
+ {\r
+ internalConnection = MySqlPoolManager.GetConnection( settings );\r
+ }\r
+ else\r
+ {\r
+ internalConnection = new MySqlInternalConnection( settings );\r
+ internalConnection.Open();\r
+ }\r
+ }\r
+ catch (Exception ex)\r
+ {\r
+ SetState( ConnectionState.Closed );\r
+ throw ex;\r
+ }\r
+\r
+\r
+ SetState( ConnectionState.Open );\r
+ internalConnection.SetServerVariables(this);\r
+ if (settings.Database != null && settings.Database != String.Empty)\r
+ ChangeDatabase( settings.Database );\r
+ }\r
+\r
+\r
+ /// <summary>\r
+ /// Closes the connection to the database. This is the preferred method of closing any open connection.\r
+ /// </summary>\r
+ public void Close()\r
+ {\r
+ if (state == ConnectionState.Closed) return;\r
+\r
+ if (dataReader != null)\r
+ dataReader.Close();\r
+\r
+ if (settings.Pooling)\r
+ MySqlPoolManager.ReleaseConnection( internalConnection );\r
+ else\r
+ internalConnection.Close();\r
+\r
+ SetState( ConnectionState.Closed );\r
+ }\r
+\r
+ IDbCommand IDbConnection.CreateCommand()\r
+ {\r
+ return CreateCommand();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Creates and returns a MySqlCommand object associated with the MySqlConnection.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public MySqlCommand CreateCommand()\r
+ {\r
+ // Return a new instance of a command object.\r
+ MySqlCommand c = new MySqlCommand();\r
+ c.Connection = this;\r
+ return c;\r
+ }\r
+\r
+ #region ICloneable\r
+ /// <summary>\r
+ /// Creates a new MySqlConnection object with the exact same ConnectionString value\r
+ /// </summary>\r
+ /// <returns>A cloned MySqlConnection object</returns>\r
+ object ICloneable.Clone()\r
+ {\r
+ MySqlConnection clone = new MySqlConnection();\r
+ clone.ConnectionString = this.ConnectionString;\r
+ //TODO: how deep should this go?\r
+ return clone;\r
+ }\r
+ #endregion\r
+\r
+ #region IDisposeable\r
+ /// <summary>\r
+ /// Releases the resources used by the MySqlConnection.\r
+ /// </summary>\r
+ public new void Dispose() \r
+ {\r
+ if (State == ConnectionState.Open)\r
+ Close();\r
+ base.Dispose();\r
+ }\r
+ #endregion\r
+ }\r
+}\r
-<?xml version="1.0" encoding="utf-8" ?>
-<root>
- <xsd:schema id="root" xmlns="" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:msdata="urn:schemas-microsoft-com:xml-msdata">
- <xsd:element name="root" msdata:IsDataSet="true">
- <xsd:complexType>
- <xsd:choice maxOccurs="unbounded">
- <xsd:element name="data">
- <xsd:complexType>
- <xsd:sequence>
- <xsd:element name="value" type="xsd:string" minOccurs="0" msdata:Ordinal="1" />
- <xsd:element name="comment" type="xsd:string" minOccurs="0" msdata:Ordinal="2" />
- </xsd:sequence>
- <xsd:attribute name="name" type="xsd:string" />
- <xsd:attribute name="type" type="xsd:string" />
- <xsd:attribute name="mimetype" type="xsd:string" />
- </xsd:complexType>
- </xsd:element>
- <xsd:element name="resheader">
- <xsd:complexType>
- <xsd:sequence>
- <xsd:element name="value" type="xsd:string" minOccurs="0" msdata:Ordinal="1" />
- </xsd:sequence>
- <xsd:attribute name="name" type="xsd:string" use="required" />
- </xsd:complexType>
- </xsd:element>
- </xsd:choice>
- </xsd:complexType>
- </xsd:element>
- </xsd:schema>
- <resheader name="ResMimeType">
- <value>text/microsoft-resx</value>
- </resheader>
- <resheader name="Version">
- <value>1.0.0.0</value>
- </resheader>
- <resheader name="Reader">
- <value>System.Resources.ResXResourceReader, System.Windows.Forms, Version=1.0.3102.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>
- </resheader>
- <resheader name="Writer">
- <value>System.Resources.ResXResourceWriter, System.Windows.Forms, Version=1.0.3102.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>
- </resheader>
-</root>
+<?xml version="1.0" encoding="utf-8" ?>\r
+<root>\r
+ <xsd:schema id="root" xmlns="" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:msdata="urn:schemas-microsoft-com:xml-msdata">\r
+ <xsd:element name="root" msdata:IsDataSet="true">\r
+ <xsd:complexType>\r
+ <xsd:choice maxOccurs="unbounded">\r
+ <xsd:element name="data">\r
+ <xsd:complexType>\r
+ <xsd:sequence>\r
+ <xsd:element name="value" type="xsd:string" minOccurs="0" msdata:Ordinal="1" />\r
+ <xsd:element name="comment" type="xsd:string" minOccurs="0" msdata:Ordinal="2" />\r
+ </xsd:sequence>\r
+ <xsd:attribute name="name" type="xsd:string" />\r
+ <xsd:attribute name="type" type="xsd:string" />\r
+ <xsd:attribute name="mimetype" type="xsd:string" />\r
+ </xsd:complexType>\r
+ </xsd:element>\r
+ <xsd:element name="resheader">\r
+ <xsd:complexType>\r
+ <xsd:sequence>\r
+ <xsd:element name="value" type="xsd:string" minOccurs="0" msdata:Ordinal="1" />\r
+ </xsd:sequence>\r
+ <xsd:attribute name="name" type="xsd:string" use="required" />\r
+ </xsd:complexType>\r
+ </xsd:element>\r
+ </xsd:choice>\r
+ </xsd:complexType>\r
+ </xsd:element>\r
+ </xsd:schema>\r
+ <resheader name="ResMimeType">\r
+ <value>text/microsoft-resx</value>\r
+ </resheader>\r
+ <resheader name="Version">\r
+ <value>1.0.0.0</value>\r
+ </resheader>\r
+ <resheader name="Reader">\r
+ <value>System.Resources.ResXResourceReader, System.Windows.Forms, Version=1.0.3102.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>\r
+ </resheader>\r
+ <resheader name="Writer">\r
+ <value>System.Resources.ResXResourceWriter, System.Windows.Forms, Version=1.0.3102.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>\r
+ </resheader>\r
+</root>\r
-using System;
-using ByteFX.Data.Common;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- ///
- /// </summary>
- internal sealed class MySqlInternalConnection
- {
- MySqlConnectionString settings;
- Driver driver;
- DateTime createTime;
- bool serverVariablesSet;
-
- public MySqlInternalConnection( MySqlConnectionString connectString )
- {
- settings = connectString;
- serverVariablesSet = false;
- }
-
- #region Properties
- public MySqlConnectionString Settings
- {
- get { return settings; }
- set { settings = value; }
- }
-
- internal Driver Driver
- {
- get { return driver; }
- }
-
- #endregion
-
- #region Methods
-
- public bool IsAlive()
- {
- Packet packet;
- try
- {
- byte[] bytes = driver.Encoding.GetBytes("select connection_id();");
- packet = driver.SendSql( bytes );
- // we have to read for two last packets since MySql sends
- // us a last packet after schema and again after rows
- // I will likely change this later to have the driver just
- // return schema in one very large packet.
- while (! packet.IsLastPacket())
- packet = driver.ReadPacket();
-
- // now read off the resultset
- packet = driver.ReadPacket();
- while (! packet.IsLastPacket())
- packet = driver.ReadPacket();
- return true;
- }
- catch (Exception ex)
- {
- return false;
- }
- }
-
- public bool IsTooOld()
- {
- TimeSpan ts = DateTime.Now.Subtract( createTime );
- if (ts.Seconds > settings.ConnectionLifetime)
- return true;
- return false;
- }
-
- /// <summary>
- /// I don't like this setup but can't think of a better way of doing
- /// right now.
- /// </summary>
- /// <param name="connection"></param>
- public void SetServerVariables(MySqlConnection connection)
- {
- if (serverVariablesSet) return;
-
- // retrieve the encoding that should be used for character data
- MySqlCommand cmd = new MySqlCommand("show variables like 'max_allowed_packet'", connection);
- try
- {
- MySqlDataReader reader = cmd.ExecuteReader();
- reader.Read();
- driver.MaxPacketSize = reader.GetInt64( 1 );
- reader.Close();
- }
- catch
- {
- driver.MaxPacketSize = 1047552;
- }
-
- cmd.CommandText = "show variables like 'character_set'";
- driver.Encoding = System.Text.Encoding.Default;
-
- try
- {
- MySqlDataReader reader = cmd.ExecuteReader();
- if (reader.Read())
- driver.Encoding = CharSetMap.GetEncoding( reader.GetString(1) );
- reader.Close();
- }
- catch
- {
- throw new MySqlException("Failure to initialize connection");
- }
-
- serverVariablesSet = true;
- }
-
- public void Open()
- {
- driver = new Driver();
- driver.Open( settings );
-
- createTime = DateTime.Now;
- }
-
- public void Close()
- {
- driver.Close();
- }
-
- #endregion
-
- }
-}
+using System;\r
+using ByteFX.Data.Common;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ internal sealed class MySqlInternalConnection\r
+ {\r
+ MySqlConnectionString settings;\r
+ Driver driver;\r
+ DateTime createTime;\r
+ bool serverVariablesSet;\r
+\r
+ public MySqlInternalConnection( MySqlConnectionString connectString )\r
+ {\r
+ settings = connectString;\r
+ serverVariablesSet = false;\r
+ }\r
+\r
+ #region Properties\r
+ public MySqlConnectionString Settings \r
+ {\r
+ get { return settings; }\r
+ set { settings = value; }\r
+ }\r
+\r
+ internal Driver Driver \r
+ {\r
+ get { return driver; }\r
+ }\r
+\r
+ #endregion\r
+\r
+ #region Methods\r
+\r
+ public bool IsAlive() \r
+ {\r
+ try \r
+ {\r
+ CommandResult result = driver.Send( DBCmd.PING, (byte[])null );\r
+ // we don't care about the result. The fact that it responded is enough\r
+ return true;\r
+ }\r
+ catch (Exception)\r
+ {\r
+ return false;\r
+ }\r
+ }\r
+\r
+ public bool IsTooOld() \r
+ {\r
+ TimeSpan ts = DateTime.Now.Subtract( createTime );\r
+ if (ts.Seconds > settings.ConnectionLifetime)\r
+ return true;\r
+ return false;\r
+ }\r
+\r
+ /// <summary>\r
+ /// I don't like this setup but can't think of a better way of doing\r
+ /// right now.\r
+ /// </summary>\r
+ /// <param name="connection"></param>\r
+ public void SetServerVariables(MySqlConnection connection)\r
+ {\r
+ if (serverVariablesSet) return;\r
+\r
+ // retrieve the encoding that should be used for character data\r
+ MySqlCommand cmd = new MySqlCommand("show variables like 'max_allowed_packet'", connection);\r
+ try \r
+ {\r
+ MySqlDataReader reader = cmd.ExecuteReader();\r
+ reader.Read();\r
+ driver.MaxPacketSize = reader.GetInt64( 1 );\r
+ reader.Close();\r
+ }\r
+ catch (Exception)\r
+ {\r
+ driver.MaxPacketSize = 1047552;\r
+ }\r
+\r
+ cmd.CommandText = "show variables like 'character_set'";\r
+ driver.Encoding = System.Text.Encoding.Default;\r
+ \r
+ try \r
+ {\r
+ MySqlDataReader reader = cmd.ExecuteReader();\r
+ if (reader.Read())\r
+ driver.Encoding = CharSetMap.GetEncoding( reader.GetString(1) );\r
+ reader.Close();\r
+ }\r
+ catch \r
+ { \r
+ throw new MySqlException("Failure to initialize connection");\r
+ }\r
+\r
+ serverVariablesSet = true;\r
+ }\r
+\r
+ public void Open() \r
+ {\r
+ driver = new Driver();\r
+ driver.Open( settings );\r
+\r
+ createTime = DateTime.Now;\r
+ }\r
+\r
+ public void Close() \r
+ {\r
+ driver.Close();\r
+ }\r
+\r
+ #endregion\r
+\r
+ }\r
+}\r
-using System;
-using ByteFX.Data.Common;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Summary description for MySqlConnectionString.
- /// </summary>
- internal sealed class MySqlConnectionString : DBConnectionString
- {
- private bool useCompression = false;
-
- public MySqlConnectionString()
- {
- connectLifetime = 0;
- pooling = true;
- minPoolSize = 0;
- maxPoolSize = 100;
- connectTimeout = 15;
- port = 3306;
- }
-
- public MySqlConnectionString(string connectString) : base(connectString)
- {
- connectLifetime = 0;
- pooling = true;
- minPoolSize = 0;
- maxPoolSize = 100;
- connectTimeout = 15;
- port = 3306;
- Parse();
- }
-
- #region Properties
- public bool UseCompression
- {
- get { return useCompression; }
- }
- #endregion
-
- protected override void ConnectionParameterParsed(string key, string value)
- {
- switch (key.ToLower())
- {
- case "use compression":
- case "compress":
- if (value.ToLower() == "no" || value.ToLower() == "false")
- useCompression = false;
- else
- useCompression = true;
- break;
- }
-
- base.ConnectionParameterParsed(key, value);
- }
-
- }
-}
+using System;\r
+using System.Collections;\r
+using System.ComponentModel;\r
+using System.Text;\r
+using ByteFX.Data.Common;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ internal enum ConnectionProtocol \r
+ {\r
+ Sockets, NamedPipe, UnixSocket\r
+ }\r
+\r
+ /// <summary>\r
+ /// Summary description for MySqlConnectionString.\r
+ /// </summary>\r
+ internal sealed class MySqlConnectionString : DBConnectionString\r
+ {\r
+ private Hashtable defaults;\r
+\r
+ public MySqlConnectionString() : base()\r
+ {\r
+ }\r
+\r
+ public MySqlConnectionString(string connectString) : this()\r
+ {\r
+ SetConnectionString( connectString );\r
+ }\r
+\r
+ #region Server Properties\r
+ [Browsable(false)]\r
+ public string Name \r
+ {\r
+ get { return connectionName; }\r
+ set { connectionName = value; }\r
+ }\r
+\r
+\r
+ [Category("Connection")]\r
+ [Description("The name or IP address of the server to use")]\r
+ public string Server \r
+ {\r
+ get { return GetString("host"); }\r
+ set { keyValues["host"] = value; }\r
+ }\r
+\r
+ [Category("Connection")]\r
+ [Description("Port to use when connecting with sockets")]\r
+ [DefaultValue(3306)]\r
+ public int Port \r
+ {\r
+ get { return GetInt("port"); }\r
+ set { keyValues["port"] = value; }\r
+ }\r
+\r
+ [Category("Connection")]\r
+ [Description("Protocol to use for connection to MySQL")]\r
+ [DefaultValue(ConnectionProtocol.Sockets)]\r
+ public ConnectionProtocol Protocol\r
+ {\r
+ get { return (ConnectionProtocol)keyValues["protocol"]; }\r
+ set { keyValues["protocol"] = value; }\r
+ }\r
+\r
+ [Category("Connection")]\r
+ [Description("Name of pipe to use when connecting with named pipes (Win32 only)")]\r
+ public string PipeName \r
+ {\r
+ get { return GetString("use pipe"); }\r
+ set { keyValues["use pipe"] = value; }\r
+ }\r
+\r
+ [Category("Connection")]\r
+ [Description("Should the connection ues compression")]\r
+ [DefaultValue(false)]\r
+ public bool UseCompression \r
+ {\r
+ get { return GetBool("compress"); }\r
+ set { keyValues["compress"] = value; }\r
+ }\r
+\r
+ [Category("Connection")]\r
+ [Description("Database to use initially")]\r
+ [Editor("ByteFX.Data.MySqlClient.Design.DatabaseTypeEditor,MySqlClient.Design", typeof(System.Drawing.Design.UITypeEditor))]\r
+ public string Database\r
+ {\r
+ get { return GetString("database"); }\r
+ set { keyValues["database"] = value; }\r
+ }\r
+\r
+ [Category("Connection")]\r
+ [Description("Number of seconds to wait for the connection to succeed")]\r
+ [DefaultValue(15)]\r
+ public int ConnectionTimeout\r
+ {\r
+ get { return GetInt("connect timeout"); }\r
+ set { keyValues["connect timeout"] = value; }\r
+ }\r
+ #endregion\r
+\r
+ #region Authentication Properties\r
+\r
+ [Category("Authentication")]\r
+ [Description("The username to connect as")]\r
+ public string UserId \r
+ {\r
+ get { return GetString("user id"); }\r
+ set { keyValues["user id"] = value; }\r
+ }\r
+\r
+ [Category("Authentication")]\r
+ [Description("The password to use for authentication")]\r
+ public string Password \r
+ {\r
+ get { return GetString("password"); }\r
+ set { keyValues["password"] = value; }\r
+ }\r
+\r
+ [Category("Authentication")]\r
+ [Description("Should the connection use SSL. This currently has no effect.")]\r
+ [DefaultValue(false)]\r
+ public bool UseSSL\r
+ {\r
+ get { return GetBool("use ssl"); }\r
+ set { keyValues["use ssl"] = value; }\r
+ }\r
+\r
+ [Category("Authentication")]\r
+ [Description("Show user password in connection string")]\r
+ [DefaultValue(false)]\r
+ public bool PersistSecurityInfo \r
+ {\r
+ get { return GetBool("persist security info"); }\r
+ set { keyValues["persist security info"] = value; }\r
+ }\r
+ #endregion\r
+\r
+ #region Pooling Properties\r
+\r
+ [Category("Pooling")]\r
+ [Description("Should the connection support pooling")]\r
+ [DefaultValue(true)]\r
+ public bool Pooling \r
+ {\r
+ get { return GetBool("pooling"); }\r
+ set { keyValues["pooling"] = value; }\r
+ }\r
+\r
+ [Category("Pooling")]\r
+ [Description("Minimum number of connections to have in this pool")]\r
+ [DefaultValue(0)]\r
+ public int MinPoolSize \r
+ {\r
+ get { return GetInt("min pool size"); }\r
+ set { keyValues["min pool size"] = value; }\r
+ }\r
+\r
+ [Category("Pooling")]\r
+ [Description("Maximum number of connections to have in this pool")]\r
+ [DefaultValue(100)]\r
+ public int MaxPoolSize \r
+ {\r
+ get { return GetInt("max pool size"); }\r
+ set { keyValues["max pool size"] = value; }\r
+ }\r
+\r
+ [Category("Pooling")]\r
+ [Description("Maximum number of seconds a connection should live. This is checked when a connection is returned to the pool.")]\r
+ [DefaultValue(0)]\r
+ public int ConnectionLifetime \r
+ {\r
+ get { return GetInt("connection lifetime"); }\r
+ set { keyValues["connection lifetime"] = value; }\r
+ }\r
+\r
+ #endregion\r
+\r
+\r
+ /// <summary>\r
+ /// Takes a given connection string and returns it, possible\r
+ /// stripping out the password info\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public string GetConnectionString()\r
+ {\r
+ if (connectString == null) return CreateConnectionString();\r
+\r
+ StringBuilder str = new StringBuilder();\r
+ Hashtable ht = ParseKeyValuePairs( connectString );\r
+\r
+ if (! PersistSecurityInfo) \r
+ ht.Remove("password");\r
+\r
+ foreach( string key in ht.Keys)\r
+ str.AppendFormat("{0}={1};", key, ht[key]);\r
+\r
+ if (str.Length > 0)\r
+ str.Remove( str.Length-1, 1 );\r
+\r
+ return str.ToString();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Uses the values in the keyValues hash to create a\r
+ /// connection string\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public string CreateConnectionString()\r
+ {\r
+ string cStr = String.Empty;\r
+\r
+ Hashtable values = (Hashtable)keyValues.Clone();\r
+ Hashtable defaultValues = GetDefaultValues();\r
+\r
+ if (!PersistSecurityInfo && values.Contains("password") )\r
+ values.Remove( "password" );\r
+\r
+ // we always return the server key. It's not needed but \r
+ // seems weird for it not to be there.\r
+ cStr = "server=" + values["host"] + ";";\r
+ values.Remove("server");\r
+\r
+ foreach (string key in values.Keys)\r
+ {\r
+ if (!values[key].Equals( defaultValues[key]))\r
+ cStr += key + "=" + values[key] + ";";\r
+ }\r
+\r
+ return cStr;\r
+ }\r
+\r
+ protected override Hashtable GetDefaultValues()\r
+ {\r
+ defaults = base.GetDefaultValues();\r
+ if (defaults == null)\r
+ {\r
+ defaults = new Hashtable();\r
+ defaults["host"] = "localhost";\r
+ defaults["connect lifetime"] = 0;\r
+ defaults["user id"] = String.Empty;\r
+ defaults["password"] = String.Empty;\r
+ defaults["pooling"] = true;\r
+ defaults["min pool size"] = 0;\r
+ defaults["protocol"] = ConnectionProtocol.Sockets;\r
+ defaults["max pool size"] = 100;\r
+ defaults["connect timeout"] = 15;\r
+ defaults["port"] = 3306;\r
+ defaults["useSSL"] = false;\r
+ defaults["compress"] = false;\r
+ defaults["persist Security Info"] = false;\r
+ }\r
+ return (Hashtable)defaults.Clone();\r
+ }\r
+\r
+ protected override bool ConnectionParameterParsed(Hashtable hash, string key, string value)\r
+ {\r
+ switch (key.ToLower()) \r
+ {\r
+ case "use compression":\r
+ case "compress":\r
+ hash["compress"] = \r
+ value.ToLower() == "yes" || value.ToLower() == "true";\r
+ return true;\r
+\r
+ case "protocol":\r
+ if (value == "socket" || value == "tcp")\r
+ hash["protocol"] = ConnectionProtocol.Sockets;\r
+ else if (value == "pipe")\r
+ hash["protocol"] = ConnectionProtocol.NamedPipe;\r
+ else if (value == "unix")\r
+ hash["protocol"] = ConnectionProtocol.UnixSocket;\r
+ return true;\r
+\r
+ case "use pipe":\r
+ case "pipe":\r
+ hash["use pipe"] = value;\r
+ return true;\r
+ }\r
+\r
+ if (! base.ConnectionParameterParsed(hash, key, value))\r
+ throw new ArgumentException("Keyword not supported: '" + key + "'");\r
+ return true;\r
+ }\r
+\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Net;
-using System.Net.Sockets;
-using System.IO;
-using ICSharpCode.SharpZipLib.Zip.Compression;
-using System.Security.Cryptography;
-using ByteFX.Data.Common;
-using System.Text;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Summary description for Driver.
- /// </summary>
- internal class Driver
- {
- protected const int HEADER_LEN = 4;
- protected const int MIN_COMPRESS_LENGTH = 50;
-
- protected MySqlStream stream;
- protected Encoding encoding;
- protected byte packetSeq;
- protected long maxPacketSize;
- protected Packet peekedPacket = null;
- protected ByteFX.Data.Common.Version serverVersion;
- protected bool isOpen;
- protected string versionString;
-
- int protocol;
- uint threadID;
- String encryptionSeed;
- int serverCaps;
- bool useCompression = false;
-
-
- public Driver()
- {
- packetSeq = 0;
- encoding = System.Text.Encoding.Default;
- isOpen = false;
- }
-
- public Encoding Encoding
- {
- get { return encoding; }
- set { encoding = value; }
- }
-
- public long MaxPacketSize
- {
- get { return maxPacketSize; }
- set { maxPacketSize = value; }
- }
-
- public string Version
- {
- get { return versionString; }
- }
-
- public void Open( MySqlConnectionString settings )
- {
- stream = new MySqlStream( settings.Host, settings.Port, 30, settings.ConnectTimeout );
-
- Packet packet = ReadPacket();
-
- // read off the protocol version
- protocol = packet.ReadByte();
- versionString = packet.ReadString();
- serverVersion = ByteFX.Data.Common.Version.Parse( versionString );
- threadID = (uint)packet.ReadInteger(4);
- encryptionSeed = packet.ReadString();
-
- // read in Server capabilities if they are provided
- serverCaps = 0;
- if (packet.HasMoreData)
- serverCaps = (int)packet.ReadInteger(2);
-
- Authenticate( settings.Username, settings.Password, settings.UseCompression );
- isOpen = true;
- }
-
- private void Authenticate( String userid, String password, bool UseCompression )
- {
- ClientParam clientParam = ClientParam.CLIENT_FOUND_ROWS | ClientParam.CLIENT_LONG_FLAG;
-
- if ((serverCaps & (int)ClientParam.CLIENT_COMPRESS) != 0 && UseCompression)
- {
- clientParam |= ClientParam.CLIENT_COMPRESS;
- }
-
- clientParam |= ClientParam.CLIENT_LONG_PASSWORD;
- clientParam |= ClientParam.CLIENT_LOCAL_FILES;
-// if (serverVersion.isAtLeast(4,1,0))
-// clientParam |= ClientParam.CLIENT_PROTOCOL_41;
- if ( (serverCaps & (int)ClientParam.CLIENT_SECURE_CONNECTION ) != 0 && password.Length > 0 )
- clientParam |= ClientParam.CLIENT_SECURE_CONNECTION;
-
- int packetLength = userid.Length + 16 + 6 + 4; // Passwords can be 16 chars long
-
- Packet packet = new Packet();// packetLength );
-
- if ((clientParam & ClientParam.CLIENT_PROTOCOL_41) != 0)
- {
- packet.WriteInteger( (int)clientParam, 4 );
- packet.WriteInteger( (256*256*256)-1, 4 );
- }
- else
- {
- packet.WriteInteger( (int)clientParam, 2 );
- packet.WriteInteger( 255*255*255, 3 );
- }
-
- packet.WriteString( userid, encoding );
- if ( (clientParam & ClientParam.CLIENT_SECURE_CONNECTION ) != 0 )
- {
- // use the new authentication system
- AuthenticateSecurely( packet, password );
- }
- else
- {
- // use old authentication system
- packet.WriteString( EncryptPassword(password, encryptionSeed, protocol > 9), encoding );
- SendPacket(packet);
- }
-
- packet = ReadPacket();
- if ((clientParam & ClientParam.CLIENT_COMPRESS) != 0)
- useCompression = true;
- }
-
- /// <summary>
- /// AuthenticateSecurity implements the new 4.1 authentication scheme
- /// </summary>
- /// <param name="packet">The in-progress packet we use to complete the authentication</param>
- /// <param name="password">The password of the user to use</param>
- private void AuthenticateSecurely( Packet packet, string password )
- {
- packet.WriteString("xxxxxxxx", encoding );
- SendPacket(packet);
-
- packet = ReadPacket();
-
- // compute pass1 hash
- string newPass = password.Replace(" ","").Replace("\t","");
- SHA1 sha = new SHA1CryptoServiceProvider();
- byte[] firstPassBytes = sha.ComputeHash( System.Text.Encoding.Default.GetBytes(newPass));
-
- byte[] salt = packet.GetBuffer();
- byte[] input = new byte[ firstPassBytes.Length + 4 ];
- salt.CopyTo( input, 0 );
- firstPassBytes.CopyTo( input, 4 );
- byte[] outPass = new byte[100];
- byte[] secondPassBytes = sha.ComputeHash( input );
-
- byte[] cryptSalt = new byte[20];
- Security.ArrayCrypt( salt, 4, cryptSalt, 0, secondPassBytes, 20 );
-
- Security.ArrayCrypt( cryptSalt, 0, firstPassBytes, 0, firstPassBytes, 20 );
-
- // send the packet
- packet = new Packet();
- packet.Write( firstPassBytes, 0, 20 );
- SendPacket(packet);
- }
-
- /// <summary>
- ///
- /// </summary>
- private Packet ReadRawPacket()
- {
- int packetLength = stream.ReadInt24();
- int unCompressedLen = 0;
-
- // read the packet sequence and make sure it makes sense
- byte seq = (byte)stream.ReadByte();
- if (seq != packetSeq)
- throw new MySqlException("Unknown transmission status: sequence out of order");
-
- if (useCompression)
- unCompressedLen = stream.ReadInt24();
-
- byte[] buffer;
- if (useCompression && unCompressedLen > 0)
- {
- byte[] compressed_buffer = new Byte[packetLength];
- buffer = new Byte[unCompressedLen];
-
- // read in the compressed data
- stream.Read( compressed_buffer, 0, packetLength );
-
- // inflate it
- Inflater i = new Inflater();
- i.SetInput( compressed_buffer );
- i.Inflate( buffer );
- }
- else
- {
- buffer = new Byte[packetLength];
- stream.Read( buffer, 0, packetLength);
- }
-
- packetSeq++;
- Packet packet = new Packet( buffer );
- packet.Encoding = encoding;
- return packet;
- }
-
- /// <summary>
- ///
- /// </summary>
- public void SendFileToServer()
- {
- }
-
- public void ClearPeekedPacket()
- {
- peekedPacket = null;
- }
-
- /// <summary>
- ///
- /// </summary>
- /// <returns></returns>
- public Packet PeekPacket()
- {
- // we can peek the same packet more than once
- if (peekedPacket != null)
- return peekedPacket;
-
- peekedPacket = ReadPacket();
- return peekedPacket;
- }
-
- /// <summary>
- ///
- /// </summary>
- /// <returns></returns>
- public Packet ReadPacket()
- {
- // if we have a peeked packet, return it now
- if (peekedPacket != null)
- {
- Packet p = peekedPacket;
- peekedPacket = null;
- return p;
- }
-
- Packet packet = ReadRawPacket();
-
- // if this is an error packet, then throw the exception
- if (packet[0] == 0xff)
- {
- packet.ReadByte();
- int errorCode = (int)packet.ReadInteger(2);
- string msg = packet.ReadString();
- throw new MySqlException( msg, errorCode );
- }
-
- return packet;
- }
-
- /// <summary>
- ///
- /// </summary>
- /// <returns></returns>
-/* protected byte[] CompressPacket(Packet packet)
- {
- // compress the entire packet except the length
-
- // make sure we are using a packet prep'ed for compression
- // and that our packet is large enough to warrant compression
- // re: my_compress.c from mysql src
- int offset = HEADER_LEN + COMPRESS_HEADER_LEN;
- int original_len = (int)(_packet.Length - offset);
- if (original_len < MIN_COMPRESS_LEN) return 0;
-
- byte[] packetData = _packet.ToArray();
-
- byte[] output = new Byte[ original_len * 2 ];
- Deflater d = new Deflater();
- d.SetInput( packetData, offset, original_len );
- d.Finish();
- int comp_len = d.Deflate( output, offset, output.Length - offset );
-
- if (comp_len > original_len) return 0;
- _packet = new MemoryStream( output, 0, comp_len + offset );
- return (int)comp_len;
- }
-*/
- protected byte[] CompressPacket(Packet packet)
- {
- if (packet.Length < MIN_COMPRESS_LENGTH) return null;
-
- byte[] compressed_buffer = new byte[packet.Length * 2];
- Deflater deflater = new Deflater();
- deflater.SetInput( packet.GetBuffer(), 0, packet.Length );
- deflater.Finish();
- int comp_len = deflater.Deflate( compressed_buffer, 0, compressed_buffer.Length );
- if (comp_len > packet.Length) return null;
- return compressed_buffer;
- }
-
- protected void SendPacket(Packet packet)
- {
- Packet header = null;
- byte[] buffer = null;
-
- if (useCompression)
- {
- byte[] compressed_bytes = CompressPacket(packet);
- header = new Packet();
-
- // if we succeeded in compressing
- if (compressed_bytes != null)
- {
- header.WriteInteger( compressed_bytes.Length, 3 );
- header.WriteByte( packetSeq );
- header.WriteInteger( packet.Length + HEADER_LEN, 3 );
- buffer = compressed_bytes;
- }
- else
- {
- header.WriteInteger( packet.Length + HEADER_LEN, 3 );
- header.WriteByte( packetSeq );
- header.WriteInteger( 0, 3 );
- buffer = packet.GetBuffer();
- }
- // now write the internal header
- header.WriteInteger( packet.Length, 3 );
- header.WriteByte( 0 );
- }
- else
- {
- buffer = packet.GetBytes( packetSeq );
- }
- packetSeq++;
-
- // send the data to eth server
- int start = 0;
- if (! useCompression) start = 3;
- stream.Write( buffer, start, packet.Length - start );
- stream.Flush();
- }
-
-
- public void Close()
- {
- if (stream != null)
- stream.Close();
- }
-
-
- /// <summary>
- /// Sends the specified command to the database
- /// </summary>
- /// <param name="command">Command to execute</param>
- /// <param name="text">Text attribute of command</param>
- /// <returns>Result packet returned from database server</returns>
- public void SendCommand( DBCmd command, String text )
- {
- Packet packet = new Packet();
- packetSeq = 0;
- packet.WriteByte( (byte)command );
- packet.WriteStringNoNull( text, encoding );
- SendPacket(packet);
-
- packet = ReadPacket();
- if (packet[0] != 0)
- throw new MySqlException("SendCommand failed for command " + text );
- }
-
- /// <summary>
- /// SendQuery sends a byte array of SQL to the server
- /// </summary>
- /// <param name="sql"></param>
- /// <returns>A packet containing the bytes returned by the server</returns>
- public Packet SendQuery( byte[] sql )
- {
- string s = encoding.GetString(sql);
-
- Packet packet = new Packet();
- packetSeq = 0;
- packet.WriteByte( (byte)DBCmd.QUERY );
- packet.Write( sql, 0, sql.Length );
-
- SendPacket( packet );
- return ReadPacket();
- }
-
-
-
- public Packet SendSql( byte[] bytes )
- {
- Packet packet = new Packet();
- packetSeq = 0;
- packet.WriteByte( (byte)DBCmd.QUERY );
- packet.Write( bytes, 0, bytes.Length );
-
- SendPacket( packet );
- packet = ReadPacket();
- return packet;
- }
-
- #region PasswordStuff
- private static double rand(ref long seed1, ref long seed2)
- {
- seed1 = (seed1 * 3) + seed2;
- seed1 %= 0x3fffffff;
- seed2 = (seed1 + seed2 + 33) % 0x3fffffff;
- return (seed1 / (double)0x3fffffff);
- }
-
- /// <summary>
- /// Encrypts a password using the MySql encryption scheme
- /// </summary>
- /// <param name="password">The password to encrypt</param>
- /// <param name="message">The encryption seed the server gave us</param>
- /// <param name="new_ver">Indicates if we should use the old or new encryption scheme</param>
- /// <returns></returns>
- public static String EncryptPassword(String password, String message, bool new_ver)
- {
- if (password == null || password.Length == 0)
- return password;
-
- long[] hash_message = Hash(message);
- long[] hash_pass = Hash(password);
-
- long seed1 = (hash_message[0]^hash_pass[0]) % 0x3fffffff;
- long seed2 = (hash_message[1]^hash_pass[1]) % 0x3fffffff;
-
- char[] scrambled = new char[message.Length];
- for (int x=0; x < message.Length; x++)
- {
- double r = rand(ref seed1, ref seed2);
- scrambled[x] = (char)(Math.Floor(r*31) + 64);
- }
-
- if (new_ver)
- { /* Make it harder to break */
- char extra = (char)Math.Floor( rand(ref seed1, ref seed2) * 31 );
- for (int x=0; x < scrambled.Length; x++)
- scrambled[x] ^= extra;
- }
-
- return new string(scrambled);
- }
-
- /// <summary>
- ///
- /// </summary>
- /// <param name="P"></param>
- /// <returns></returns>
- static long[] Hash(String P)
- {
- long val1 = 1345345333;
- long val2 = 0x12345671;
- long inc = 7;
-
- for (int i=0; i < P.Length; i++)
- {
- if (P[i] == ' ' || P[i] == '\t') continue;
- long temp = (long)(0xff & P[i]);
- val1 ^= (((val1 & 63)+inc)*temp) + (val1 << 8);
- val2 += (val2 << 8) ^ val1;
- inc += temp;
- }
-
- long[] hash = new long[2];
- hash[0] = val1 & 0x7fffffff;
- hash[1] = val2 & 0x7fffffff;
- return hash;
- }
- #endregion
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Net;\r
+using System.Net.Sockets;\r
+using System.IO;\r
+using ICSharpCode.SharpZipLib.Zip.Compression;\r
+using ICSharpCode.SharpZipLib.Zip.Compression.Streams;\r
+using System.Security.Cryptography;\r
+using ByteFX.Data.Common;\r
+using System.Collections;\r
+using System.Text;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Summary description for Driver.\r
+ /// </summary>\r
+ internal class Driver\r
+ {\r
+ protected const int HEADER_LEN = 4;\r
+ protected const int MIN_COMPRESS_LENGTH = 50;\r
+ protected const int MAX_PACKET_SIZE = 256*256*256-1;\r
+\r
+ protected Stream stream;\r
+ protected BufferedStream writer;\r
+ protected Encoding encoding;\r
+ protected byte packetSeq;\r
+ protected long maxPacketSize;\r
+ protected DBVersion serverVersion;\r
+ protected bool isOpen;\r
+ protected string versionString;\r
+ protected Packet peekedPacket;\r
+\r
+ protected int protocol;\r
+ protected uint threadID;\r
+ protected String encryptionSeed;\r
+ protected int serverCaps;\r
+ protected bool useCompression = false;\r
+\r
+\r
+ public Driver()\r
+ {\r
+ packetSeq = 0;\r
+ encoding = System.Text.Encoding.Default;\r
+ isOpen = false;\r
+ }\r
+\r
+ public Encoding Encoding \r
+ {\r
+ get { return encoding; }\r
+ set { encoding = value; }\r
+ }\r
+\r
+ public long MaxPacketSize \r
+ {\r
+ get { return maxPacketSize; }\r
+ set { maxPacketSize = value; }\r
+ }\r
+\r
+ public string VersionString \r
+ {\r
+ get { return versionString; }\r
+ }\r
+\r
+ public DBVersion Version \r
+ {\r
+ get { return serverVersion; }\r
+ }\r
+\r
+ public void Open( MySqlConnectionString settings )\r
+ {\r
+ // connect to one of our specified hosts\r
+ try \r
+ {\r
+ StreamCreator sc = new StreamCreator( settings.Server, settings.Port, settings.PipeName );\r
+ stream = sc.GetStream( settings.ConnectionTimeout );\r
+ }\r
+ catch (Exception ex)\r
+ {\r
+ throw new MySqlException("Unable to connect to any of the specified MySQL hosts", ex);\r
+ }\r
+\r
+ if (stream == null) \r
+ throw new MySqlException("Unable to connect to any of the specified MySQL hosts");\r
+\r
+ writer = new BufferedStream( stream );\r
+ // read off the welcome packet and parse out it's values\r
+ Packet packet = ReadPacket();\r
+ protocol = packet.ReadByte();\r
+ versionString = packet.ReadString();\r
+ serverVersion = DBVersion.Parse( versionString );\r
+ threadID = (uint)packet.ReadInteger(4);\r
+ encryptionSeed = packet.ReadString();\r
+\r
+ // read in Server capabilities if they are provided\r
+ serverCaps = 0;\r
+ if (packet.HasMoreData)\r
+ serverCaps = (int)packet.ReadInteger(2);\r
+\r
+ Authenticate( settings.UserId, settings.Password, settings.UseCompression );\r
+\r
+ // if we are using compression, then we use our CompressedStream class\r
+ // to hide the ugliness of managing the compression\r
+ if (settings.UseCompression)\r
+ {\r
+ stream = new CompressedStream( stream );\r
+ writer = new BufferedStream( stream );\r
+ }\r
+\r
+ isOpen = true;\r
+ }\r
+\r
+ private Packet CreatePacket( byte[] buf )\r
+ {\r
+ if (buf == null)\r
+ return new Packet( serverVersion.isAtLeast(3, 22, 5) );\r
+ return new Packet( buf, serverVersion.isAtLeast(3, 22, 5 ));\r
+ }\r
+\r
+ private void Authenticate( String userid, String password, bool UseCompression )\r
+ {\r
+ ClientParam clientParam = ClientParam.CLIENT_FOUND_ROWS | ClientParam.CLIENT_LONG_FLAG;\r
+\r
+ if ((serverCaps & (int)ClientParam.CLIENT_COMPRESS) != 0 && UseCompression)\r
+ {\r
+ clientParam |= ClientParam.CLIENT_COMPRESS;\r
+ }\r
+\r
+ clientParam |= ClientParam.CLIENT_LONG_PASSWORD;\r
+ clientParam |= ClientParam.CLIENT_LOCAL_FILES;\r
+// if (serverVersion.isAtLeast(4,1,0))\r
+// clientParam |= ClientParam.CLIENT_PROTOCOL_41;\r
+// if ( (serverCaps & (int)ClientParam.CLIENT_SECURE_CONNECTION ) != 0 && password.Length > 0 )\r
+// clientParam |= ClientParam.CLIENT_SECURE_CONNECTION;\r
+\r
+ int packetLength = userid.Length + 16 + 6 + 4; // Passwords can be 16 chars long\r
+\r
+ Packet packet = CreatePacket(null);\r
+\r
+ if ((clientParam & ClientParam.CLIENT_PROTOCOL_41) != 0)\r
+ {\r
+ packet.WriteInteger( (int)clientParam, 4 );\r
+ packet.WriteInteger( (256*256*256)-1, 4 );\r
+ }\r
+ else\r
+ {\r
+ packet.WriteInteger( (int)clientParam, 2 );\r
+ packet.WriteInteger( 255*255*255, 3 );\r
+ }\r
+\r
+ packet.WriteString( userid, encoding );\r
+ if ( (clientParam & ClientParam.CLIENT_SECURE_CONNECTION ) != 0 )\r
+ {\r
+ // use the new authentication system\r
+ AuthenticateSecurely( packet, password );\r
+ }\r
+ else\r
+ {\r
+ // use old authentication system\r
+ packet.WriteString( EncryptPassword(password, encryptionSeed, protocol > 9), encoding );\r
+ // pad zeros out to packetLength for auth\r
+ for (int i=0; i < (packetLength-packet.Length); i++)\r
+ packet.WriteByte(0);\r
+ SendPacket(packet);\r
+ }\r
+\r
+ packet = ReadPacket();\r
+ if ((clientParam & ClientParam.CLIENT_COMPRESS) != 0)\r
+ useCompression = true;\r
+ }\r
+\r
+ /// <summary>\r
+ /// AuthenticateSecurity implements the new 4.1 authentication scheme\r
+ /// </summary>\r
+ /// <param name="packet">The in-progress packet we use to complete the authentication</param>\r
+ /// <param name="password">The password of the user to use</param>\r
+ private void AuthenticateSecurely( Packet packet, string password )\r
+ {\r
+ packet.WriteString("xxxxxxxx", encoding );\r
+ SendPacket(packet);\r
+\r
+ packet = ReadPacket();\r
+\r
+ // compute pass1 hash\r
+ string newPass = password.Replace(" ","").Replace("\t","");\r
+ SHA1 sha = new SHA1CryptoServiceProvider(); \r
+ byte[] firstPassBytes = sha.ComputeHash( System.Text.Encoding.Default.GetBytes(newPass));\r
+\r
+ byte[] salt = packet.GetBuffer();\r
+ byte[] input = new byte[ firstPassBytes.Length + 4 ];\r
+ salt.CopyTo( input, 0 );\r
+ firstPassBytes.CopyTo( input, 4 );\r
+ byte[] outPass = new byte[100];\r
+ byte[] secondPassBytes = sha.ComputeHash( input );\r
+\r
+ byte[] cryptSalt = new byte[20];\r
+ Security.ArrayCrypt( salt, 4, cryptSalt, 0, secondPassBytes, 20 );\r
+\r
+ Security.ArrayCrypt( cryptSalt, 0, firstPassBytes, 0, firstPassBytes, 20 );\r
+\r
+ // send the packet\r
+ packet = CreatePacket(null);\r
+ packet.Write( firstPassBytes, 0, 20 );\r
+ SendPacket(packet);\r
+ }\r
+\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public Packet PeekPacket()\r
+ {\r
+ if (peekedPacket != null)\r
+ return peekedPacket;\r
+\r
+ peekedPacket = ReadPacket();\r
+ return peekedPacket;\r
+ }\r
+\r
+ /// <summary>\r
+ /// ReadBuffer continuously loops until it has read the entire\r
+ /// requested data\r
+ /// </summary>\r
+ /// <param name="buf">Buffer to read data into</param>\r
+ /// <param name="offset">Offset to place the data</param>\r
+ /// <param name="length">Number of bytes to read</param>\r
+ private void ReadBuffer( byte[] buf, int offset, int length )\r
+ {\r
+ while (length > 0)\r
+ {\r
+ int amountRead = stream.Read( buf, offset, length );\r
+ if (amountRead == 0)\r
+ throw new MySqlException("Unexpected end of data encountered");\r
+ length -= amountRead;\r
+ offset += amountRead;\r
+ }\r
+ }\r
+\r
+ private Packet ReadPacketFromServer()\r
+ {\r
+ int len = stream.ReadByte() + (stream.ReadByte() << 8) +\r
+ (stream.ReadByte() << 16);\r
+ byte seq = (byte)stream.ReadByte();\r
+ byte[] buf = new byte[ len ];\r
+ ReadBuffer( buf, 0, len );\r
+\r
+ if (seq != packetSeq) \r
+ throw new MySqlException("Unknown transmission status: sequence out of order");\r
+ packetSeq++;\r
+\r
+ Packet p = CreatePacket(buf);\r
+ p.Encoding = this.Encoding;\r
+ if (p.Length == MAX_PACKET_SIZE && serverVersion.isAtLeast(4,0,0)) \r
+ p.Append( ReadPacketFromServer() );\r
+ return p;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Reads a single packet off the stream\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public Packet ReadPacket()\r
+ {\r
+ // if we have peeked at a packet, then return it\r
+ if (peekedPacket != null)\r
+ {\r
+ Packet packet = peekedPacket;\r
+ peekedPacket = null;\r
+ return packet;\r
+ }\r
+\r
+ Packet p = ReadPacketFromServer();\r
+\r
+ // if this is an error packet, then throw the exception\r
+ if (p[0] == 0xff)\r
+ {\r
+ p.ReadByte();\r
+ int errorCode = (int)p.ReadInteger(2);\r
+ string msg = p.ReadString();\r
+ throw new MySqlException( msg, errorCode );\r
+ }\r
+ \r
+ return p;\r
+ }\r
+\r
+ protected MemoryStream CompressBuffer(byte[] buf, int index, int length)\r
+ {\r
+\r
+ if (length < MIN_COMPRESS_LENGTH) return null;\r
+\r
+ MemoryStream ms = new MemoryStream(buf.Length);\r
+ DeflaterOutputStream dos = new DeflaterOutputStream(ms);\r
+\r
+ dos.WriteByte( (byte)(length & 0xff ));\r
+ dos.WriteByte( (byte)((length >> 8) & 0xff ));\r
+ dos.WriteByte( (byte)((length >> 16) & 0xff ));\r
+ dos.WriteByte( 0 );\r
+\r
+ dos.Write( buf, index, length );\r
+ dos.Finish();\r
+ if (ms.Length > length+4) return null;\r
+ return ms;\r
+ }\r
+\r
+ private void WriteInteger( int v, int numbytes )\r
+ {\r
+ int val = v;\r
+\r
+ if (numbytes < 1 || numbytes > 4) \r
+ throw new ArgumentOutOfRangeException("Wrong byte count for WriteInteger");\r
+\r
+ for (int x=0; x < numbytes; x++)\r
+ {\r
+ writer.WriteByte( (byte)(val&0xff) );\r
+ val >>= 8;\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Send a buffer to the server in a compressed form\r
+ /// </summary>\r
+ /// <param name="buf">Byte buffer to send</param>\r
+ /// <param name="index">Location in buffer to start sending</param>\r
+ /// <param name="length">Amount of data to send</param>\r
+ protected void SendCompressedBuffer(byte[] buf, int index, int length)\r
+ {\r
+ MemoryStream compressed_bytes = CompressBuffer(buf, index, length);\r
+ int comp_len = compressed_bytes == null ? length+HEADER_LEN : (int)compressed_bytes.Length;\r
+ int ucomp_len = compressed_bytes == null ? 0 : length+HEADER_LEN;\r
+\r
+ WriteInteger( comp_len, 3 );\r
+ writer.WriteByte( packetSeq++ );\r
+ WriteInteger( ucomp_len, 3 );\r
+ if (compressed_bytes != null)\r
+ writer.Write( compressed_bytes.GetBuffer(), 0, (int)compressed_bytes.Length );\r
+ else \r
+ {\r
+ WriteInteger( length, 3 ); \r
+ writer.WriteByte( 0 );\r
+ writer.Write( buf, index, length );\r
+ }\r
+ stream.Flush();\r
+ }\r
+\r
+ protected void SendBuffer( byte[] buf, int offset, int length )\r
+ {\r
+ while (length > 0)\r
+ {\r
+ int amount = Math.Min( 1024, length );\r
+ writer.Write( buf, offset, amount );\r
+ writer.Flush();\r
+ offset += amount;\r
+ length -= amount;\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Send a single packet to the server.\r
+ /// </summary>\r
+ /// <param name="packet">Packet to send to the server</param>\r
+ /// <remarks>This method will send a single packet to the server\r
+ /// possibly breaking the packet up into smaller packets that are\r
+ /// smaller than max_allowed_packet. This method will always send at\r
+ /// least one packet to the server</remarks>\r
+ protected void SendPacket(Packet packet)\r
+ {\r
+ byte[] buf = packet.GetBuffer();\r
+ int len = packet.Length;\r
+ int index = 0;\r
+ bool oneSent = false;\r
+\r
+ // make sure we are not trying to send too much\r
+ if (packet.Length > maxPacketSize && maxPacketSize > 0)\r
+ throw new MySqlException("Packet size too large. This MySQL server cannot accept rows larger than " + maxPacketSize + " bytes.");\r
+\r
+ try \r
+ {\r
+ while (len > 0 || ! oneSent) \r
+ {\r
+ int lenToSend = Math.Min( len, MAX_PACKET_SIZE );\r
+\r
+ // send the data\r
+ if (useCompression)\r
+ SendCompressedBuffer( buf, index, lenToSend );\r
+ else \r
+ {\r
+ WriteInteger( lenToSend, 3 );\r
+ writer.WriteByte( packetSeq++ );\r
+ writer.Write( buf, index, lenToSend );\r
+ writer.Flush();\r
+ }\r
+\r
+ len -= lenToSend;\r
+ index += lenToSend;\r
+ oneSent = true;\r
+ }\r
+ writer.Flush();\r
+ }\r
+ catch (Exception ex)\r
+ {\r
+ Console.WriteLine( ex.Message );\r
+ }\r
+ }\r
+\r
+\r
+ public void Close() \r
+ {\r
+ if (stream != null)\r
+ stream.Close();\r
+ }\r
+\r
+\r
+ /// <summary>\r
+ /// Sends the specified command to the database\r
+ /// </summary>\r
+ /// <param name="command">Command to execute</param>\r
+ /// <param name="text">Text attribute of command</param>\r
+ /// <returns>Result packet returned from database server</returns>\r
+ public void Send( DBCmd command, String text ) \r
+ {\r
+ CommandResult result = Send( command, this.Encoding.GetBytes( text ) );\r
+ if (result.IsResultSet)\r
+ throw new MySqlException("SendCommand failed for command " + text );\r
+ }\r
+\r
+ public CommandResult Send( DBCmd cmd, byte[] bytes )\r
+ {\r
+// string s = Encoding.GetString( bytes );\r
+\r
+ Packet packet = CreatePacket(null);\r
+ packetSeq = 0;\r
+ packet.WriteByte( (byte)cmd );\r
+ if (bytes != null)\r
+ packet.Write( bytes, 0, bytes.Length );\r
+\r
+ SendPacket( packet );\r
+ packet = ReadPacket();\r
+\r
+ // first check to see if this is a LOAD DATA LOCAL callback\r
+ // if so, send the file and then read the results\r
+ long fieldcount = packet.ReadLenInteger();\r
+ if (fieldcount == Packet.NULL_LEN)\r
+ {\r
+ string filename = packet.ReadString();\r
+ SendFileToServer( filename );\r
+ packet = ReadPacket();\r
+ }\r
+ else\r
+ packet.Position = 0;\r
+\r
+ return new CommandResult(packet, this);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Sends the specified file to the server. \r
+ /// This supports the LOAD DATA LOCAL INFILE\r
+ /// </summary>\r
+ /// <param name="filename"></param>\r
+ private void SendFileToServer( string filename )\r
+ {\r
+ Packet p = CreatePacket(null);\r
+ byte[] buffer = new byte[4092];\r
+ FileStream fs = null;\r
+ try \r
+ {\r
+ fs = new FileStream( filename, FileMode.Open );\r
+ int count = fs.Read( buffer, 0, buffer.Length );\r
+ while (count != 0) \r
+ {\r
+ if ((p.Length + count) > MAX_PACKET_SIZE)\r
+ {\r
+ SendPacket( p );\r
+ p.Clear();\r
+ }\r
+ p.Write( buffer, 0, count );\r
+ count = fs.Read( buffer, 0, buffer.Length );\r
+ }\r
+ fs.Close();\r
+\r
+ // send any remaining data\r
+ if (p.Length > 0) \r
+ {\r
+ SendPacket(p);\r
+ p.Clear();\r
+ }\r
+ }\r
+ catch (Exception ex)\r
+ {\r
+ throw new MySqlException("Error during LOAD DATA LOCAL INFILE", ex);\r
+ }\r
+ finally \r
+ {\r
+ if (fs != null)\r
+ fs.Close();\r
+ // empty packet signals end of file\r
+ p.Clear();\r
+ SendPacket(p);\r
+ }\r
+ }\r
+\r
+ #region PasswordStuff\r
+ private static double rand(ref long seed1, ref long seed2)\r
+ {\r
+ seed1 = (seed1 * 3) + seed2;\r
+ seed1 %= 0x3fffffff;\r
+ seed2 = (seed1 + seed2 + 33) % 0x3fffffff;\r
+ return (seed1 / (double)0x3fffffff);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Encrypts a password using the MySql encryption scheme\r
+ /// </summary>\r
+ /// <param name="password">The password to encrypt</param>\r
+ /// <param name="message">The encryption seed the server gave us</param>\r
+ /// <param name="new_ver">Indicates if we should use the old or new encryption scheme</param>\r
+ /// <returns></returns>\r
+ public static String EncryptPassword(String password, String message, bool new_ver)\r
+ {\r
+ if (password == null || password.Length == 0)\r
+ return password;\r
+\r
+ long[] hash_message = Hash(message);\r
+ long[] hash_pass = Hash(password);\r
+\r
+ long seed1 = (hash_message[0]^hash_pass[0]) % 0x3fffffff;\r
+ long seed2 = (hash_message[1]^hash_pass[1]) % 0x3fffffff;\r
+\r
+ char[] scrambled = new char[message.Length];\r
+ for (int x=0; x < message.Length; x++) \r
+ {\r
+ double r = rand(ref seed1, ref seed2);\r
+ scrambled[x] = (char)(Math.Floor(r*31) + 64);\r
+ }\r
+\r
+ if (new_ver)\r
+ { /* Make it harder to break */\r
+ char extra = (char)Math.Floor( rand(ref seed1, ref seed2) * 31 );\r
+ for (int x=0; x < scrambled.Length; x++)\r
+ scrambled[x] ^= extra;\r
+ }\r
+\r
+ return new string(scrambled);\r
+ }\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ /// <param name="P"></param>\r
+ /// <returns></returns>\r
+ static long[] Hash(String P) \r
+ {\r
+ long val1 = 1345345333;\r
+ long val2 = 0x12345671;\r
+ long inc = 7;\r
+\r
+ for (int i=0; i < P.Length; i++) \r
+ {\r
+ if (P[i] == ' ' || P[i] == '\t') continue;\r
+ long temp = (long)(0xff & P[i]);\r
+ val1 ^= (((val1 & 63)+inc)*temp) + (val1 << 8);\r
+ val2 += (val2 << 8) ^ val1;\r
+ inc += temp;\r
+ }\r
+\r
+ long[] hash = new long[2];\r
+ hash[0] = val1 & 0x7fffffff;\r
+ hash[1] = val2 & 0x7fffffff;\r
+ return hash;\r
+ }\r
+ #endregion\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Runtime.Serialization;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// The exception that is thrown when MySQL returns an error. This class cannot be inherited.
- /// </summary>
- /// <include file='docs/MySqlException.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>
- [Serializable]
- public sealed class MySqlException : SystemException
- {
- internal MySqlException(string msg) : base(msg)
- {
- }
-
- internal MySqlException( string msg, Exception ex ) : base(msg, ex)
- {
- }
-
- internal MySqlException()
- {
- }
-
- internal MySqlException(string msg, int errno) : base(msg)
- {
-
- }
-
- internal MySqlException(SerializationInfo info,
- StreamingContext context) : base(info, context)
- {
- }
-
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Runtime.Serialization;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// The exception that is thrown when MySQL returns an error. This class cannot be inherited.\r
+ /// </summary>\r
+ /// <include file='docs/MySqlException.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>\r
+ [Serializable]\r
+ public sealed class MySqlException : SystemException\r
+ {\r
+ private int errorCode;\r
+\r
+ internal MySqlException(string msg) : base(msg)\r
+ {\r
+ }\r
+ \r
+ internal MySqlException( string msg, Exception ex ) : base(msg, ex)\r
+ {\r
+ }\r
+\r
+ internal MySqlException() \r
+ {\r
+ }\r
+\r
+ internal MySqlException(string msg, int errno) : base(msg)\r
+ {\r
+ errorCode = errno; \r
+ }\r
+\r
+ internal MySqlException(SerializationInfo info,\r
+ StreamingContext context) : base(info, context)\r
+ {\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets a number that identifies the type of error.\r
+ /// </summary>\r
+ public int Number \r
+ {\r
+ get { return errorCode; }\r
+ }\r
+\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Data;
-using System.Data.SqlTypes;
-using System.Globalization;
-using System.Text;
-
-namespace ByteFX.Data.MySqlClient
-{
- internal enum ColFlags : int
- {
- NOT_NULL = 1,
- PRIMARY_KEY = 2,
- UNIQUE_KEY = 4,
- MULTIPLE_KEY = 8,
- BLOB = 16,
- UNSIGNED = 32,
- ZERO_FILL = 64,
- BINARY = 128,
- ENUM = 256,
- AUTO_INCREMENT = 512,
- TIMESTAMP = 1024,
- SET = 2048,
- NUMBER = 32768
- };
-
- /// <summary>
- /// Summary description for Field.
- /// </summary>
- internal class MySqlField : Common.Field
- {
- MySqlDbType colType;
- public ColFlags colFlags;
- public int colDecimals;
-// System.Text.Encoding encoding;
- private static NumberFormatInfo numberFormat = null;
-
-
- public MySqlField()
- {
-// this.encoding = encoding;
- if (numberFormat == null)
- {
- numberFormat = (NumberFormatInfo)NumberFormatInfo.InvariantInfo.Clone();
- numberFormat.NumberDecimalSeparator = ".";
- }
- }
-
- public void ReadSchemaInfo( Packet packet )
- {
- tableName = packet.ReadLenString();
- colName = packet.ReadLenString();
- colLen = (int)packet.ReadNBytes();
- colType = (MySqlDbType)packet.ReadNBytes();
- packet.ReadByte(); // this is apparently 2 -- not sure what it is for
- colFlags = (ColFlags)packet.ReadInteger(2); //(short)(d.ReadByte() & 0xff);
- colDecimals = packet.ReadByte();
- }
-
- public object GetValue()
- {
- return value;
- }
-
- public int NumericPrecision()
- {
- if (colType == MySqlDbType.Decimal)
- return colLen;
- return -1;
- }
-
- public int NumericScale()
- {
- if (colType == MySqlDbType.Decimal)
- return colDecimals;
- return -1;
- }
-
- public bool IsAutoIncrement()
- {
- return (colFlags & ColFlags.AUTO_INCREMENT) > 0;
- }
-
- public bool IsNumeric()
- {
- return (colFlags & ColFlags.NUMBER) > 0;
- }
-
- public bool AllowsNull()
- {
- return (colFlags & ColFlags.NOT_NULL) == 0;
- }
-
- public bool IsUnique()
- {
- return (colFlags & ColFlags.UNIQUE_KEY) > 0;
- }
-
- public bool IsPrimaryKey()
- {
- return (colFlags & ColFlags.PRIMARY_KEY) > 0;
- }
-
- public bool IsBlob()
- {
- return (colFlags & ColFlags.BLOB) > 0;
- }
-
- public bool IsBinary()
- {
- return (colFlags & ColFlags.BINARY) > 0;
- }
-
- public bool IsUnsigned()
- {
- return (colFlags & ColFlags.UNSIGNED) > 0;
- }
-
- public void SetValueData( Packet p, Encoding encoding )
- {
- int len = p.ReadLenInteger();
- if (len == -1)
- {
- value = DBNull.Value;
- return;
- }
-
- // read in the data
- byte[] data = new byte[ len ];
- p.Read( data, 0, len );
-
- // if it is a blob and binary, then GetBytes is the way to go
- if ( IsBlob() && IsBinary() )
- {
- dbType = DbType.Binary;
- value = data;
- return;
- }
-
- string sValue = encoding.GetString( data );//Chars(data, offset, count );
- //string sValue = new string(_Chars);
-
- switch(colType)
- {
- case MySqlDbType.Byte:
- if (IsUnsigned())
- value = Byte.Parse( sValue );
- else
- value = SByte.Parse( sValue );
- break;
-
- case MySqlDbType.Short:
- if (IsUnsigned())
- value = UInt16.Parse( sValue );
- else
- value = Int16.Parse( sValue );
- break;
-
- case MySqlDbType.Int :
- case MySqlDbType.Int24:
- if (IsUnsigned())
- value = UInt32.Parse( sValue );
- else
- value = Int32.Parse( sValue );
- break;
-
- case MySqlDbType.BigInt:
- if (IsUnsigned())
- value = UInt64.Parse( sValue );
- else
- value = Int64.Parse( sValue );
- break;
-
- case MySqlDbType.Decimal:
- value = Decimal.Parse( sValue , numberFormat );
- break;
-
- case MySqlDbType.Float:
- value = Convert.ToSingle( sValue, numberFormat );
- break;
-
- case MySqlDbType.Double:
- value = Convert.ToDouble( sValue, numberFormat );
- break;
-
- case MySqlDbType.Date:
- ParseDateValue( "0000-00-00", "yyyy-MM-dd", sValue );
- break;
-
- case MySqlDbType.Datetime:
- ParseDateValue( "0000-00-00 00:00:00", "yyyy-MM-dd HH:mm:ss", sValue );
- break;
-
- case MySqlDbType.Time:
- if (sValue.Equals("00:00:00"))
- value = DBNull.Value;
- else
- value = TimeSpan.Parse(sValue);
- break;
-
- case MySqlDbType.Timestamp:
- string pattern;
- string null_value = "00000000000000";
- switch (ColumnLength)
- {
- case 2: pattern = "yy"; break;
- case 4: pattern = "yyMM"; break;
- case 6: pattern = "yyMMdd"; break;
- case 8: pattern = "yyyyMMdd"; break;
- case 10: pattern = "yyMMddHHmm"; break;
- case 12: pattern = "yyMMddHHmmss"; break;
- case 14:
- default: pattern = "yyyyMMddHHmmss"; break;
- }
-
- if (ColumnLength > 2 && sValue.Equals( null_value.Substring(0, ColumnLength)))
- value = DBNull.Value;
- else
- value = DateTime.ParseExact( sValue, pattern, new System.Globalization.DateTimeFormatInfo());
- break;
-
- case MySqlDbType.String:
- case MySqlDbType.VarChar:
- case MySqlDbType.Blob:
- case MySqlDbType.TinyBlob:
- case MySqlDbType.LongBlob:
- case MySqlDbType.MediumBlob:
- value = sValue;
- break;
-
- default:
- throw new NotSupportedException();
- }
- }
-
- protected void ParseDateValue( string nullpattern, string pattern, string data )
- {
- if ( data.Equals (nullpattern) )
- value = DBNull.Value;
- else
- value = DateTime.ParseExact( data, pattern, new System.Globalization.DateTimeFormatInfo());
- }
-
- public string GetFieldTypeName()
- {
- switch (colType)
- {
- case MySqlDbType.Decimal: return "DECIMAL";
- case MySqlDbType.Byte: return "TINY";
- case MySqlDbType.Short: return "SHORT";
- case MySqlDbType.Int: return "INTEGER";
- case MySqlDbType.Float: return "FLOAT";
- case MySqlDbType.Double: return "DOUBLE";
- case MySqlDbType.Null: return "NULL";
- case MySqlDbType.Timestamp: return "TIMESTAMP";
- case MySqlDbType.BigInt: return "BIGINT";
- case MySqlDbType.Int24: return "INT24";
- case MySqlDbType.Date: return "DATE";
- case MySqlDbType.Time: return "TIME";
- case MySqlDbType.Datetime: return "DATETIME";
- case MySqlDbType.Year: return "YEAR";
- case MySqlDbType.Newdate: return "NEWDATE";
- case MySqlDbType.Enum: return "ENUM";
- case MySqlDbType.Set: return "SET";
- case MySqlDbType.TinyBlob: return "TINY_BLOB";
- case MySqlDbType.MediumBlob: return "MEDIUM_BLOB";
- case MySqlDbType.LongBlob: return "LONG_BLOB";
- case MySqlDbType.Blob: return "BLOB";
- case MySqlDbType.VarChar: return "VAR_STRING";
- case MySqlDbType.String: return "STRING";
- }
- return "Unknown typeid";
- }
-
-
- public Type GetFieldType()
- {
- switch (colType)
- {
- case MySqlDbType.Byte: return IsUnsigned() ? typeof(System.Byte) : typeof(System.SByte);
-
- case MySqlDbType.Short: return IsUnsigned() ? typeof(System.UInt16) : typeof(System.Int16);
-
- case MySqlDbType.Int:
- case MySqlDbType.Int24: return IsUnsigned() ? typeof(System.UInt32) : typeof(System.Int32);
-
- case MySqlDbType.BigInt: return IsUnsigned() ? typeof(System.UInt64) : typeof(System.Int64);
-
- case MySqlDbType.Float: return typeof(System.Single);
- case MySqlDbType.Double: return typeof(System.Double);
-
- case MySqlDbType.Time: return typeof(System.TimeSpan);
-
- case MySqlDbType.Date:
- case MySqlDbType.Datetime:
- case MySqlDbType.Timestamp: return typeof(System.DateTime);
-
- case MySqlDbType.Decimal: return typeof(System.Decimal);
-
- case MySqlDbType.VarChar:
- case MySqlDbType.String: return typeof(System.String);
-
- case MySqlDbType.TinyBlob:
- case MySqlDbType.MediumBlob:
- case MySqlDbType.LongBlob:
- case MySqlDbType.Blob: return typeof(System.Array);
-
- default:
- case MySqlDbType.Null: return typeof(System.DBNull);
- }
- }
-
- public MySqlDbType GetMySqlDbType()
- {
- return colType;
- }
-
- public DbType GetDbType()
- {
- switch (colType)
- {
- case MySqlDbType.Decimal: return DbType.Decimal;
- case MySqlDbType.Byte: return DbType.Byte;
- case MySqlDbType.Short:
- if (IsUnsigned())
- return DbType.UInt16;
- else
- return DbType.Int16;
-
- case MySqlDbType.Int:
- if (IsUnsigned())
- return DbType.UInt32;
- else
- return DbType.Int32;
-
- case MySqlDbType.Float: return DbType.Single;
- case MySqlDbType.Double: return DbType.Double;
- case MySqlDbType.Null: return DbType.Object;
-
- case MySqlDbType.BigInt:
- if (IsUnsigned())
- return DbType.UInt64;
- else
- return DbType.Int64;
-
- case MySqlDbType.Int24:
- if (IsUnsigned())
- return DbType.UInt32;
- else
- return DbType.Int32;
- case MySqlDbType.Date:
- case MySqlDbType.Year:
- case MySqlDbType.Newdate:
- return DbType.Date;
-
- case MySqlDbType.Time:
- return DbType.Time;
- case MySqlDbType.Datetime:
- case MySqlDbType.Timestamp:
- return DbType.DateTime;
-
- case MySqlDbType.Enum: return DbType.UInt32;
- case MySqlDbType.Set: return DbType.Object;
-
- case MySqlDbType.TinyBlob:
- case MySqlDbType.MediumBlob:
- case MySqlDbType.LongBlob:
- case MySqlDbType.Blob:
- if (IsBinary()) return DbType.Binary;
- return DbType.String;
- case MySqlDbType.VarChar:
- return DbType.String;
- case MySqlDbType.String:
- return DbType.StringFixedLength;
- }
- throw new Exception("unknown MySqlDbType");
- }
-
- }
-
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Data;\r
+using System.Data.SqlTypes;\r
+using System.Globalization;\r
+using System.Text;\r
+using ByteFX.Data.Common;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ internal enum ColumnFlags : int\r
+ {\r
+ NOT_NULL = 1,\r
+ PRIMARY_KEY = 2,\r
+ UNIQUE_KEY = 4,\r
+ MULTIPLE_KEY = 8,\r
+ BLOB = 16,\r
+ UNSIGNED = 32,\r
+ ZERO_FILL = 64,\r
+ BINARY = 128,\r
+ ENUM = 256,\r
+ AUTO_INCREMENT = 512,\r
+ TIMESTAMP = 1024,\r
+ SET = 2048,\r
+ NUMBER = 32768\r
+ };\r
+ \r
+ /// <summary>\r
+ /// Summary description for Field.\r
+ /// </summary>\r
+ internal class MySqlField : Common.Field\r
+ {\r
+ protected MySqlDbType colType;\r
+ protected ColumnFlags colFlags;\r
+ protected int colDecimals;\r
+ protected Encoding encoding;\r
+ private static NumberFormatInfo numberFormat = null;\r
+\r
+ protected byte[] buffer;\r
+ protected long bufIndex;\r
+ protected long bufLength;\r
+\r
+ public MySqlField(Encoding encoding)\r
+ {\r
+ this.encoding = encoding;\r
+ if (numberFormat == null)\r
+ {\r
+ numberFormat = (NumberFormatInfo)NumberFormatInfo.InvariantInfo.Clone();\r
+ numberFormat.NumberDecimalSeparator = ".";\r
+ }\r
+ }\r
+\r
+ public byte[] Buffer \r
+ {\r
+ get { return buffer; }\r
+ }\r
+\r
+ public long BufferIndex \r
+ {\r
+ get { return bufIndex; }\r
+ }\r
+\r
+ public long BufferLength \r
+ {\r
+ get { return bufLength; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// CopyBuffer makes a copy of the byte buffer given to us while\r
+ /// the rowset was being read\r
+ /// </summary>\r
+ private void CopyBuffer()\r
+ {\r
+ byte[] newbuf = new byte[ bufLength ];\r
+ long oldIndex = bufIndex;\r
+ for (long i=0; i < bufLength; i++)\r
+ newbuf[i] = buffer[ oldIndex++ ];\r
+ bufIndex = 0;\r
+ buffer = newbuf;\r
+ value = newbuf;\r
+ }\r
+\r
+ /// <summary>\r
+ /// GetValue returns an object that represents the value of this field.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public object GetValue() \r
+ {\r
+ // if our value is a byte buffer and we are using only \r
+ // a part of that buffer, then we need to make a copy\r
+ if (value is byte[] && (bufIndex > 0 || bufLength < buffer.Length))\r
+ CopyBuffer();\r
+ return value;\r
+ }\r
+\r
+ public MySqlDbType Type \r
+ {\r
+ get { return colType; }\r
+ set { colType = value; }\r
+ }\r
+\r
+ public int NumericPrecision\r
+ {\r
+ get \r
+ {\r
+ if (colType == MySqlDbType.Decimal)\r
+ return colLen;\r
+ return -1;\r
+ }\r
+\r
+ }\r
+\r
+ public int NumericScale\r
+ {\r
+ get \r
+ {\r
+ if (colType == MySqlDbType.Decimal)\r
+ return colDecimals;\r
+ return -1;\r
+ }\r
+ set \r
+ {\r
+ colDecimals = value;\r
+ }\r
+ }\r
+\r
+ public ColumnFlags Flags \r
+ { \r
+ get { return colFlags; }\r
+ set { colFlags = value; }\r
+ }\r
+\r
+ public bool IsAutoIncrement()\r
+ {\r
+ return (colFlags & ColumnFlags.AUTO_INCREMENT) > 0;\r
+ }\r
+\r
+ public bool IsNumeric()\r
+ {\r
+ return (colFlags & ColumnFlags.NUMBER) > 0;\r
+ }\r
+\r
+ public bool AllowsNull()\r
+ {\r
+ return (colFlags & ColumnFlags.NOT_NULL) == 0;\r
+ }\r
+\r
+ public bool IsUnique()\r
+ {\r
+ return (colFlags & ColumnFlags.UNIQUE_KEY) > 0;\r
+ }\r
+\r
+ public bool IsPrimaryKey()\r
+ {\r
+ return (colFlags & ColumnFlags.PRIMARY_KEY) > 0;\r
+ }\r
+\r
+ public bool IsBlob() \r
+ {\r
+ return (colFlags & ColumnFlags.BLOB) > 0;\r
+ }\r
+\r
+ public bool IsBinary()\r
+ {\r
+ return (colFlags & ColumnFlags.BINARY) > 0;\r
+ }\r
+\r
+ public bool IsUnsigned()\r
+ {\r
+ return (colFlags & ColumnFlags.UNSIGNED) > 0;\r
+ }\r
+\r
+ public void SetValueData( byte[] buf, long index, long len, DBVersion version )\r
+ {\r
+ if (len == -1)\r
+ {\r
+ value = DBNull.Value;\r
+ buffer = null;\r
+ return;\r
+ }\r
+\r
+ buffer = buf;\r
+ bufIndex = index;\r
+ bufLength = len;\r
+\r
+ // if it is a blob and binary, then GetBytes is the way to go\r
+ if ( IsBlob() && IsBinary() ) \r
+ {\r
+ dbType = DbType.Binary;\r
+ value = buffer;\r
+ return;\r
+ }\r
+\r
+ string sValue = encoding.GetString( buf, (int)index, (int)len );\r
+\r
+ switch(colType)\r
+ {\r
+ case MySqlDbType.Byte:\r
+ if (IsUnsigned())\r
+ value = Byte.Parse( sValue );\r
+ else\r
+ value = SByte.Parse( sValue );\r
+ break;\r
+\r
+ case MySqlDbType.Short:\r
+ if (IsUnsigned())\r
+ value = UInt16.Parse( sValue );\r
+ else\r
+ value = Int16.Parse( sValue );\r
+ break;\r
+ \r
+ case MySqlDbType.Int : \r
+ case MySqlDbType.Int24:\r
+ if (IsUnsigned())\r
+ value = UInt32.Parse( sValue );\r
+ else\r
+ value = Int32.Parse( sValue );\r
+ break;\r
+\r
+ case MySqlDbType.BigInt:\r
+ if (IsUnsigned())\r
+ value = UInt64.Parse( sValue );\r
+ else\r
+ value = Int64.Parse( sValue );\r
+ break;\r
+\r
+ case MySqlDbType.Decimal:\r
+ value = Decimal.Parse( sValue , numberFormat );\r
+ break;\r
+\r
+ case MySqlDbType.Float:\r
+ value = Convert.ToSingle( sValue, numberFormat );\r
+ break;\r
+\r
+ case MySqlDbType.Double:\r
+ value = Convert.ToDouble( sValue, numberFormat );\r
+ break;\r
+\r
+ case MySqlDbType.Year:\r
+ value = Int32.Parse( sValue );\r
+ break;\r
+\r
+ case MySqlDbType.Date:\r
+ ParseDateValue( "0000-00-00", "yyyy-MM-dd", sValue );\r
+ break;\r
+\r
+ case MySqlDbType.Datetime:\r
+ ParseDateValue( "0000-00-00 00:00:00", "yyyy-MM-dd HH:mm:ss", sValue );\r
+ break;\r
+\r
+ case MySqlDbType.Time:\r
+ if (sValue.Equals("00:00:00"))\r
+ value = DBNull.Value;\r
+ else\r
+ value = TimeSpan.Parse(sValue);\r
+ break;\r
+\r
+ case MySqlDbType.Timestamp:\r
+ // MySql 4.1.0 and later use DateTime format for timestamp\r
+ if (version.isAtLeast(4,1,0)) \r
+ {\r
+ ParseDateValue( "0000-00-00 00:00:00", "yyyy-MM-dd HH:mm:ss", sValue );\r
+ return;\r
+ }\r
+\r
+ string pattern;\r
+ string null_value = "00000000000000";\r
+ switch (ColumnLength) \r
+ {\r
+ case 2: pattern = "yy"; break;\r
+ case 4: pattern = "yyMM"; break;\r
+ case 6: pattern = "yyMMdd"; break;\r
+ case 8: pattern = "yyyyMMdd"; break;\r
+ case 10: pattern = "yyMMddHHmm"; break;\r
+ case 12: pattern = "yyMMddHHmmss"; break;\r
+ case 14: \r
+ default: pattern = "yyyyMMddHHmmss"; break;\r
+ }\r
+\r
+ if (ColumnLength > 2 && sValue.Equals( null_value.Substring(0, ColumnLength)))\r
+ value = DBNull.Value;\r
+ else\r
+ value = DateTime.ParseExact( sValue, pattern, new System.Globalization.DateTimeFormatInfo());\r
+ break;\r
+\r
+ case MySqlDbType.String:\r
+ case MySqlDbType.VarChar:\r
+ case MySqlDbType.Blob:\r
+ case MySqlDbType.TinyBlob:\r
+ case MySqlDbType.LongBlob:\r
+ case MySqlDbType.MediumBlob: \r
+ value = sValue;\r
+ break;\r
+\r
+ default:\r
+ throw new NotSupportedException();\r
+ }\r
+ }\r
+\r
+ protected void ParseDateValue( string nullpattern, string pattern, string data )\r
+ {\r
+ if ( data.Equals (nullpattern) )\r
+ value = DBNull.Value;\r
+ else\r
+ value = DateTime.ParseExact( data, pattern, new System.Globalization.DateTimeFormatInfo());\r
+ }\r
+\r
+ public string GetFieldTypeName() \r
+ {\r
+ switch (colType) \r
+ {\r
+ case MySqlDbType.Decimal: return "DECIMAL";\r
+ case MySqlDbType.Byte: return "TINY";\r
+ case MySqlDbType.Short: return "SHORT";\r
+ case MySqlDbType.Int: return "INTEGER";\r
+ case MySqlDbType.Float: return "FLOAT";\r
+ case MySqlDbType.Double: return "DOUBLE";\r
+ case MySqlDbType.Null: return "NULL";\r
+ case MySqlDbType.Timestamp: return "TIMESTAMP";\r
+ case MySqlDbType.BigInt: return "BIGINT";\r
+ case MySqlDbType.Int24: return "INT24";\r
+ case MySqlDbType.Date: return "DATE";\r
+ case MySqlDbType.Time: return "TIME";\r
+ case MySqlDbType.Datetime: return "DATETIME";\r
+ case MySqlDbType.Year: return "YEAR";\r
+ case MySqlDbType.Newdate: return "NEWDATE";\r
+ case MySqlDbType.Enum: return "ENUM";\r
+ case MySqlDbType.Set: return "SET";\r
+ case MySqlDbType.TinyBlob: return "TINY_BLOB";\r
+ case MySqlDbType.MediumBlob: return "MEDIUM_BLOB";\r
+ case MySqlDbType.LongBlob: return "LONG_BLOB";\r
+ case MySqlDbType.Blob: return "BLOB";\r
+ case MySqlDbType.VarChar: return "VAR_STRING";\r
+ case MySqlDbType.String: return "STRING";\r
+ }\r
+ return "Unknown typeid";\r
+ }\r
+\r
+\r
+ public Type GetFieldType() \r
+ {\r
+ switch (colType) \r
+ {\r
+ case MySqlDbType.Byte: return IsUnsigned() ? typeof(System.Byte) : typeof(System.SByte);\r
+\r
+ case MySqlDbType.Short: return IsUnsigned() ? typeof(System.UInt16) : typeof(System.Int16);\r
+\r
+ case MySqlDbType.Int:\r
+ case MySqlDbType.Int24: return IsUnsigned() ? typeof(System.UInt32) : typeof(System.Int32);\r
+\r
+ case MySqlDbType.BigInt: return IsUnsigned() ? typeof(System.UInt64) : typeof(System.Int64);\r
+\r
+ case MySqlDbType.Float: return typeof(System.Single);\r
+ case MySqlDbType.Double: return typeof(System.Double);\r
+\r
+ case MySqlDbType.Time: return typeof(System.TimeSpan);\r
+\r
+ case MySqlDbType.Date:\r
+ case MySqlDbType.Datetime:\r
+ case MySqlDbType.Timestamp: return typeof(System.DateTime);\r
+\r
+ case MySqlDbType.Decimal: return typeof(System.Decimal);\r
+\r
+ case MySqlDbType.VarChar: \r
+ case MySqlDbType.String: return typeof(System.String);\r
+\r
+ case MySqlDbType.TinyBlob:\r
+ case MySqlDbType.MediumBlob:\r
+ case MySqlDbType.LongBlob:\r
+ case MySqlDbType.Blob: \r
+ if ((colFlags & ColumnFlags.BINARY) != 0)\r
+ return typeof(System.Array);\r
+ else\r
+ return typeof(System.String);\r
+\r
+ case MySqlDbType.Year:\r
+ return typeof(System.Int32);\r
+\r
+ default:\r
+ case MySqlDbType.Null: return typeof(System.DBNull);\r
+ }\r
+ }\r
+\r
+ public DbType GetDbType() \r
+ {\r
+ switch (colType) \r
+ {\r
+ case MySqlDbType.Decimal: return DbType.Decimal;\r
+ case MySqlDbType.Byte: return DbType.Byte;\r
+ case MySqlDbType.Short: \r
+ if (IsUnsigned())\r
+ return DbType.UInt16;\r
+ else\r
+ return DbType.Int16;\r
+\r
+ case MySqlDbType.Int: \r
+ if (IsUnsigned())\r
+ return DbType.UInt32;\r
+ else\r
+ return DbType.Int32;\r
+\r
+ case MySqlDbType.Float: return DbType.Single;\r
+ case MySqlDbType.Double: return DbType.Double;\r
+ case MySqlDbType.Null: return DbType.Object;\r
+\r
+ case MySqlDbType.BigInt: \r
+ if (IsUnsigned())\r
+ return DbType.UInt64;\r
+ else\r
+ return DbType.Int64;\r
+\r
+ case MySqlDbType.Int24: \r
+ if (IsUnsigned())\r
+ return DbType.UInt32;\r
+ else\r
+ return DbType.Int32;\r
+ case MySqlDbType.Date: \r
+ case MySqlDbType.Year:\r
+ case MySqlDbType.Newdate:\r
+ return DbType.Date;\r
+\r
+ case MySqlDbType.Time: \r
+ return DbType.Time;\r
+ case MySqlDbType.Datetime: \r
+ case MySqlDbType.Timestamp:\r
+ return DbType.DateTime;\r
+\r
+ case MySqlDbType.Enum: return DbType.UInt32;\r
+ case MySqlDbType.Set: return DbType.Object;\r
+\r
+ case MySqlDbType.TinyBlob: \r
+ case MySqlDbType.MediumBlob:\r
+ case MySqlDbType.LongBlob:\r
+ case MySqlDbType.Blob:\r
+ if (IsBinary()) return DbType.Binary;\r
+ return DbType.String;\r
+ case MySqlDbType.VarChar:\r
+ return DbType.String;\r
+ case MySqlDbType.String:\r
+ return DbType.StringFixedLength;\r
+ }\r
+ throw new Exception("unknown MySqlDbType");\r
+ }\r
+\r
+ }\r
+\r
+}\r
--- /dev/null
+using System;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ public class MySqlError\r
+ {\r
+/* ER_HASHCHK=1000,\r
+ ER_NISAMCHK=1001,\r
+ ER_NO=1002,\r
+ ER_YES 1003\r
+ ER_CANT_CREATE_FILE 1004\r
+ ER_CANT_CREATE_TABLE 1005\r
+ ER_CANT_CREATE_DB 1006\r
+ ER_DB_CREATE_EXISTS 1007\r
+ ER_DB_DROP_EXISTS 1008\r
+ ER_DB_DROP_DELETE 1009\r
+ ER_DB_DROP_RMDIR 1010\r
+ ER_CANT_DELETE_FILE 1011\r
+ ER_CANT_FIND_SYSTEM_REC 1012\r
+ ER_CANT_GET_STAT 1013\r
+ ER_CANT_GET_WD 1014\r
+ ER_CANT_LOCK 1015\r
+ ER_CANT_OPEN_FILE 1016\r
+ ER_FILE_NOT_FOUND 1017\r
+ ER_CANT_READ_DIR 1018\r
+ ER_CANT_SET_WD 1019\r
+ ER_CHECKREAD 1020\r
+ ER_DISK_FULL 1021\r
+ */\r
+ public static int DuplicateKey = 1022;\r
+/* ER_ERROR_ON_CLOSE 1023\r
+ ER_ERROR_ON_READ 1024\r
+ ER_ERROR_ON_RENAME 1025\r
+ ER_ERROR_ON_WRITE 1026\r
+ ER_FILE_USED 1027\r
+ ER_FILSORT_ABORT 1028\r
+ ER_FORM_NOT_FOUND 1029\r
+ ER_GET_ERRNO 1030\r
+ ER_ILLEGAL_HA 1031*/\r
+ public static int KeyNotFound = 1032;\r
+/* ER_NOT_FORM_FILE 1033\r
+ ER_NOT_KEYFILE 1034\r
+ ER_OLD_KEYFILE 1035\r
+ ER_OPEN_AS_READONLY 1036\r
+ ER_OUTOFMEMORY 1037\r
+ ER_OUT_OF_SORTMEMORY 1038\r
+ ER_UNEXPECTED_EOF 1039\r
+ ER_CON_COUNT_ERROR 1040\r
+ ER_OUT_OF_RESOURCES 1041\r
+ ER_BAD_HOST_ERROR 1042\r
+ ER_HANDSHAKE_ERROR 1043\r
+ ER_DBACCESS_DENIED_ERROR 1044\r
+ ER_ACCESS_DENIED_ERROR 1045\r
+ ER_NO_DB_ERROR 1046\r
+ ER_UNKNOWN_COM_ERROR 1047\r
+ ER_BAD_NULL_ERROR 1048\r
+ ER_BAD_DB_ERROR 1049\r
+ ER_TABLE_EXISTS_ERROR 1050\r
+ ER_BAD_TABLE_ERROR 1051\r
+ ER_NON_UNIQ_ERROR 1052\r
+ ER_SERVER_SHUTDOWN 1053\r
+ ER_BAD_FIELD_ERROR 1054\r
+ ER_WRONG_FIELD_WITH_GROUP 1055\r
+ ER_WRONG_GROUP_FIELD 1056\r
+ ER_WRONG_SUM_SELECT 1057\r
+ ER_WRONG_VALUE_COUNT 1058\r
+ ER_TOO_LONG_IDENT 1059\r
+ ER_DUP_FIELDNAME 1060*/\r
+ public static int DuplicateKeyName = 1061;\r
+ public static int DuplicateKeyEntry = 1062;\r
+ /* ER_WRONG_FIELD_SPEC 1063\r
+ ER_PARSE_ERROR 1064\r
+ ER_EMPTY_QUERY 1065\r
+ ER_NONUNIQ_TABLE 1066\r
+ ER_INVALID_DEFAULT 1067\r
+ ER_MULTIPLE_PRI_KEY 1068\r
+ ER_TOO_MANY_KEYS 1069\r
+ ER_TOO_MANY_KEY_PARTS 1070\r
+ ER_TOO_LONG_KEY 1071\r
+ ER_KEY_COLUMN_DOES_NOT_EXITS 1072\r
+ ER_BLOB_USED_AS_KEY 1073\r
+ ER_TOO_BIG_FIELDLENGTH 1074\r
+ ER_WRONG_AUTO_KEY 1075\r
+ ER_READY 1076\r
+ ER_NORMAL_SHUTDOWN 1077\r
+ ER_GOT_SIGNAL 1078\r
+ ER_SHUTDOWN_COMPLETE 1079\r
+ ER_FORCING_CLOSE 1080\r
+ ER_IPSOCK_ERROR 1081\r
+ ER_NO_SUCH_INDEX 1082\r
+ ER_WRONG_FIELD_TERMINATORS 1083\r
+ ER_BLOBS_AND_NO_TERMINATED 1084\r
+ ER_TEXTFILE_NOT_READABLE 1085\r
+ ER_FILE_EXISTS_ERROR 1086\r
+ ER_LOAD_INFO 1087\r
+ ER_ALTER_INFO 1088\r
+ ER_WRONG_SUB_KEY 1089\r
+ ER_CANT_REMOVE_ALL_FIELDS 1090\r
+ ER_CANT_DROP_FIELD_OR_KEY 1091\r
+ ER_INSERT_INFO 1092\r
+ ER_INSERT_TABLE_USED 1093\r
+ ER_NO_SUCH_THREAD 1094\r
+ ER_KILL_DENIED_ERROR 1095\r
+ ER_NO_TABLES_USED 1096\r
+ ER_TOO_BIG_SET 1097\r
+ ER_NO_UNIQUE_LOGFILE 1098\r
+ ER_TABLE_NOT_LOCKED_FOR_WRITE 1099\r
+ ER_TABLE_NOT_LOCKED 1100\r
+ ER_BLOB_CANT_HAVE_DEFAULT 1101\r
+ ER_WRONG_DB_NAME 1102\r
+ ER_WRONG_TABLE_NAME 1103\r
+ ER_TOO_BIG_SELECT 1104\r
+ ER_UNKNOWN_ERROR 1105\r
+ ER_UNKNOWN_PROCEDURE 1106\r
+ ER_WRONG_PARAMCOUNT_TO_PROCEDURE 1107\r
+ ER_WRONG_PARAMETERS_TO_PROCEDURE 1108\r
+ ER_UNKNOWN_TABLE 1109\r
+ ER_FIELD_SPECIFIED_TWICE 1110\r
+ ER_INVALID_GROUP_FUNC_USE 1111\r
+ ER_UNSUPPORTED_EXTENSION 1112\r
+ ER_TABLE_MUST_HAVE_COLUMNS 1113\r
+ ER_RECORD_FILE_FULL 1114\r
+ ER_UNKNOWN_CHARACTER_SET 1115\r
+ ER_TOO_MANY_TABLES 1116\r
+ ER_TOO_MANY_FIELDS 1117\r
+ ER_TOO_BIG_ROWSIZE 1118\r
+ ER_STACK_OVERRUN 1119\r
+ ER_WRONG_OUTER_JOIN 1120\r
+ ER_NULL_COLUMN_IN_INDEX 1121\r
+ ER_CANT_FIND_UDF 1122\r
+ ER_CANT_INITIALIZE_UDF 1123\r
+ ER_UDF_NO_PATHS 1124\r
+ ER_UDF_EXISTS 1125\r
+ ER_CANT_OPEN_LIBRARY 1126\r
+ ER_CANT_FIND_DL_ENTRY 1127\r
+ ER_FUNCTION_NOT_DEFINED 1128\r
+ ER_HOST_IS_BLOCKED 1129\r
+ */\r
+ public static int HostNotPrivileged = 1130;\r
+ public static int AnonymousUser = 1131;\r
+ public static int PasswordNotAllowed = 1132;\r
+ public static int PasswordNoMatch = 1133;\r
+/* ER_UPDATE_INFO 1134\r
+ ER_CANT_CREATE_THREAD 1135\r
+ ER_WRONG_VALUE_COUNT_ON_ROW 1136\r
+ ER_CANT_REOPEN_TABLE 1137\r
+ ER_INVALID_USE_OF_NULL 1138\r
+ ER_REGEXP_ERROR 1139\r
+ ER_MIX_OF_GROUP_FUNC_AND_FIELDS 1140\r
+ ER_NONEXISTING_GRANT 1141\r
+ ER_TABLEACCESS_DENIED_ERROR 1142\r
+ ER_COLUMNACCESS_DENIED_ERROR 1143\r
+ ER_ILLEGAL_GRANT_FOR_TABLE 1144\r
+ ER_GRANT_WRONG_HOST_OR_USER 1145\r
+ ER_NO_SUCH_TABLE 1146\r
+ ER_NONEXISTING_TABLE_GRANT 1147\r
+ ER_NOT_ALLOWED_COMMAND 1148\r
+ ER_SYNTAX_ERROR 1149\r
+ ER_DELAYED_CANT_CHANGE_LOCK 1150\r
+ ER_TOO_MANY_DELAYED_THREADS 1151\r
+ ER_ABORTING_CONNECTION 1152\r
+ ER_NET_PACKET_TOO_LARGE 1153\r
+ ER_NET_READ_ERROR_FROM_PIPE 1154\r
+ ER_NET_FCNTL_ERROR 1155\r
+ ER_NET_PACKETS_OUT_OF_ORDER 1156\r
+ ER_NET_UNCOMPRESS_ERROR 1157\r
+ ER_NET_READ_ERROR 1158\r
+ ER_NET_READ_INTERRUPTED 1159\r
+ ER_NET_ERROR_ON_WRITE 1160\r
+ ER_NET_WRITE_INTERRUPTED 1161\r
+ ER_TOO_LONG_STRING 1162\r
+ ER_TABLE_CANT_HANDLE_BLOB 1163\r
+ ER_TABLE_CANT_HANDLE_AUTO_INCREMENT 1164\r
+ ER_DELAYED_INSERT_TABLE_LOCKED 1165\r
+ ER_WRONG_COLUMN_NAME 1166\r
+ ER_WRONG_KEY_COLUMN 1167\r
+ ER_WRONG_MRG_TABLE 1168\r
+ ER_DUP_UNIQUE 1169\r
+ ER_BLOB_KEY_WITHOUT_LENGTH 1170\r
+ ER_PRIMARY_CANT_HAVE_NULL 1171\r
+ ER_TOO_MANY_ROWS 1172\r
+ ER_REQUIRES_PRIMARY_KEY 1173\r
+ ER_NO_RAID_COMPILED 1174\r
+ ER_UPDATE_WITHOUT_KEY_IN_SAFE_MODE 1175\r
+ ER_KEY_DOES_NOT_EXITS 1176\r
+ ER_CHECK_NO_SUCH_TABLE 1177\r
+ ER_CHECK_NOT_IMPLEMENTED 1178\r
+ ER_CANT_DO_THIS_DURING_AN_TRANSACTION 1179\r
+ ER_ERROR_DURING_COMMIT 1180\r
+ ER_ERROR_DURING_ROLLBACK 1181\r
+ ER_ERROR_DURING_FLUSH_LOGS 1182\r
+ ER_ERROR_DURING_CHECKPOINT 1183\r
+ ER_NEW_ABORTING_CONNECTION 1184\r
+ ER_DUMP_NOT_IMPLEMENTED 1185\r
+ ER_FLUSH_MASTER_BINLOG_CLOSED 1186\r
+ ER_INDEX_REBUILD 1187\r
+ ER_MASTER 1188\r
+ ER_MASTER_NET_READ 1189\r
+ ER_MASTER_NET_WRITE 1190\r
+ ER_FT_MATCHING_KEY_NOT_FOUND 1191\r
+ ER_LOCK_OR_ACTIVE_TRANSACTION 1192\r
+ ER_UNKNOWN_SYSTEM_VARIABLE 1193\r
+ ER_CRASHED_ON_USAGE 1194\r
+ ER_CRASHED_ON_REPAIR 1195\r
+ ER_WARNING_NOT_COMPLETE_ROLLBACK 1196\r
+ ER_TRANS_CACHE_FULL 1197\r
+ ER_SLAVE_MUST_STOP 1198\r
+ ER_SLAVE_NOT_RUNNING 1199\r
+ ER_BAD_SLAVE 1200\r
+ ER_MASTER_INFO 1201\r
+ ER_SLAVE_THREAD 1202\r
+ ER_TOO_MANY_USER_CONNECTIONS 1203\r
+ ER_SET_CONSTANTS_ONLY 1204\r
+ ER_LOCK_WAIT_TIMEOUT 1205\r
+ ER_LOCK_TABLE_FULL 1206\r
+ ER_READ_ONLY_TRANSACTION 1207\r
+ ER_DROP_DB_WITH_READ_LOCK 1208\r
+ ER_CREATE_DB_WITH_READ_LOCK 1209\r
+ ER_WRONG_ARGUMENTS 1210\r
+ ER_NO_PERMISSION_TO_CREATE_USER 1211\r
+ ER_UNION_TABLES_IN_DIFFERENT_DIR 1212\r
+ ER_LOCK_DEADLOCK 1213\r
+ ER_TABLE_CANT_HANDLE_FULLTEXT 1214\r
+ ER_CANNOT_ADD_FOREIGN 1215\r
+ ER_NO_REFERENCED_ROW 1216\r
+ ER_ROW_IS_REFERENCED 1217\r
+ ER_CONNECT_TO_MASTER 1218\r
+ ER_QUERY_ON_MASTER 1219\r
+ ER_ERROR_WHEN_EXECUTING_COMMAND 1220\r
+ ER_WRONG_USAGE 1221\r
+ ER_WRONG_NUMBER_OF_COLUMNS_IN_SELECT 1222\r
+ ER_CANT_UPDATE_WITH_READLOCK 1223\r
+ ER_MIXING_NOT_ALLOWED 1224\r
+ ER_DUP_ARGUMENT 1225\r
+ ER_USER_LIMIT_REACHED 1226\r
+ ER_SPECIFIC_ACCESS_DENIED_ERROR 1227\r
+ ER_LOCAL_VARIABLE 1228\r
+ ER_GLOBAL_VARIABLE 1229\r
+ ER_NO_DEFAULT 1230\r
+ ER_WRONG_VALUE_FOR_VAR 1231\r
+ ER_WRONG_TYPE_FOR_VAR 1232\r
+ ER_VAR_CANT_BE_READ 1233\r
+ ER_CANT_USE_OPTION_HERE 1234\r
+ ER_NOT_SUPPORTED_YET 1235\r
+ ER_MASTER_FATAL_ERROR_READING_BINLOG 1236\r
+ ER_SLAVE_IGNORED_TABLE 1237 // only the slave SQL thread can be sent this \r
+ ER_ERROR_MESSAGES 238*/\r
+\r
+ };\r
+}\r
-using System;
-using System.Data;
-using ByteFX.Data.MySqlClient;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Helper class that makes it easier to work with the provider.
- /// </summary>
- public sealed class MySqlHelper
- {
- // this class provides only static methods
- private MySqlHelper()
- {
- }
-
- #region ExecuteNonQuery
-
- /// <summary>
- /// Executes a single command against a MySQL database. The <see cref="MySqlConnection"/> is assumed to be
- /// open when the method is called and remains open after the method completes.
- /// </summary>
- /// <param name="connection"><see cref="MySqlConnection"/> object to use</param>
- /// <param name="commandText">SQL command to be executed</param>
- /// <param name="commandParameters">Array of <see cref="MySqlParameter"/> objects to use with the command.</param>
- /// <returns></returns>
- public static int ExecuteNonQuery( MySqlConnection connection, string commandText, params MySqlParameter[] commandParameters )
- {
- //create a command and prepare it for execution
- MySqlCommand cmd = new MySqlCommand();
- cmd.Connection = connection;
- cmd.CommandText = commandText;
- cmd.CommandType = CommandType.Text;
-
- if (commandParameters != null)
- foreach (MySqlParameter p in commandParameters)
- cmd.Parameters.Add( p );
-
- int result = cmd.ExecuteNonQuery();
- cmd.Parameters.Clear();
-
- return result;
- }
-
- /// <summary>
- /// Executes a single command against a MySQL database. A new <see cref="MySqlConnection"/> is created
- /// using the <see cref="MySqlConnection.ConnectionString"/> given.
- /// </summary>
- /// <param name="connectionString"><see cref="MySqlConnection.ConnectionString"/> to use</param>
- /// <param name="commandText">SQL command to be executed</param>
- /// <param name="parms">Array of <see cref="MySqlParameter"/> objects to use with the command.</param>
- /// <returns></returns>
- public static int ExecuteNonQuery( string connectionString, string commandText, params MySqlParameter[] parms )
- {
- //create & open a SqlConnection, and dispose of it after we are done.
- using (MySqlConnection cn = new MySqlConnection(connectionString))
- {
- cn.Open();
-
- //call the overload that takes a connection in place of the connection string
- return ExecuteNonQuery(cn, commandText, parms );
- }
- }
- #endregion
-
- #region ExecuteDataSet
-
- /// <summary>
- /// Executes a single SQL command and returns the first row of the resultset. A new MySqlConnection object
- /// is created, opened, and closed during this method.
- /// </summary>
- /// <param name="connectionString">Settings to be used for the connection</param>
- /// <param name="commandText">Command to execute</param>
- /// <param name="parms">Parameters to use for the command</param>
- /// <returns>DataRow containing the first row of the resultset</returns>
- public static DataRow ExecuteDatarow( string connectionString, string commandText, params MySqlParameter[] parms )
- {
- DataSet ds = ExecuteDataset( connectionString, commandText, parms );
- if (ds == null) return null;
- if (ds.Tables.Count == 0) return null;
- if (ds.Tables[0].Rows.Count == 0) return null;
- return ds.Tables[0].Rows[0];
- }
-
- /// <summary>
- /// Executes a single SQL command and returns the resultset in a <see cref="DataSet"/>.
- /// A new MySqlConnection object is created, opened, and closed during this method.
- /// </summary>
- /// <param name="connectionString">Settings to be used for the connection</param>
- /// <param name="commandText">Command to execute</param>
- /// <returns><see cref="DataSet"/> containing the resultset</returns>
- public static DataSet ExecuteDataset(string connectionString, string commandText)
- {
- //pass through the call providing null for the set of SqlParameters
- return ExecuteDataset(connectionString, commandText, (MySqlParameter[])null);
- }
-
- /// <summary>
- /// Executes a single SQL command and returns the resultset in a <see cref="DataSet"/>.
- /// A new MySqlConnection object is created, opened, and closed during this method.
- /// </summary>
- /// <param name="connectionString">Settings to be used for the connection</param>
- /// <param name="commandText">Command to execute</param>
- /// <param name="commandParameters">Parameters to use for the command</param>
- /// <returns><see cref="DataSet"/> containing the resultset</returns>
- public static DataSet ExecuteDataset(string connectionString, string commandText, params MySqlParameter[] commandParameters)
- {
- //create & open a SqlConnection, and dispose of it after we are done.
- using (MySqlConnection cn = new MySqlConnection(connectionString))
- {
- cn.Open();
-
- //call the overload that takes a connection in place of the connection string
- return ExecuteDataset(cn, commandText, commandParameters);
- }
- }
-
- /// <summary>
- /// Executes a single SQL command and returns the resultset in a <see cref="DataSet"/>.
- /// The state of the <see cref="MySqlConnection"/> object remains unchanged after execution
- /// of this method.
- /// </summary>
- /// <param name="connection"><see cref="MySqlConnection"/> object to use</param>
- /// <param name="commandText">Command to execute</param>
- /// <returns><see cref="DataSet"/> containing the resultset</returns>
- public static DataSet ExecuteDataset(MySqlConnection connection, string commandText)
- {
- //pass through the call providing null for the set of SqlParameters
- return ExecuteDataset(connection, commandText, (MySqlParameter[])null);
- }
-
- /// <summary>
- /// Executes a single SQL command and returns the resultset in a <see cref="DataSet"/>.
- /// The state of the <see cref="MySqlConnection"/> object remains unchanged after execution
- /// of this method.
- /// </summary>
- /// <param name="connection"><see cref="MySqlConnection"/> object to use</param>
- /// <param name="commandText">Command to execute</param>
- /// <param name="commandParameters">Parameters to use for the command</param>
- /// <returns><see cref="DataSet"/> containing the resultset</returns>
- public static DataSet ExecuteDataset(MySqlConnection connection, string commandText, params MySqlParameter[] commandParameters)
- {
- //create a command and prepare it for execution
- MySqlCommand cmd = new MySqlCommand();
- cmd.Connection = connection;
- cmd.CommandText = commandText;
- cmd.CommandType = CommandType.Text;
-
- if (commandParameters != null)
- foreach (MySqlParameter p in commandParameters)
- cmd.Parameters.Add( p );
-
- //create the DataAdapter & DataSet
- MySqlDataAdapter da = new MySqlDataAdapter(cmd);
- DataSet ds = new DataSet();
-
- //fill the DataSet using default values for DataTable names, etc.
- da.Fill(ds);
-
- // detach the MySqlParameters from the command object, so they can be used again.
- cmd.Parameters.Clear();
-
- //return the dataset
- return ds;
- }
-
- /// <summary>
- /// Updates the given table with data from the given <see cref="DataSet"/>
- /// </summary>
- /// <param name="connectionString">Settings to use for the update</param>
- /// <param name="commandText">Command text to use for the update</param>
- /// <param name="ds"><see cref="DataSet"/> containing the new data to use in the update</param>
- /// <param name="tablename">Tablename in the dataset to update</param>
- public static void UpdateDataSet( string connectionString, string commandText, DataSet ds, string tablename )
- {
- MySqlConnection cn = new MySqlConnection( connectionString );
- cn.Open();
- MySqlDataAdapter da = new MySqlDataAdapter( commandText, cn );
- MySqlCommandBuilder cb = new MySqlCommandBuilder( da );
- da.Update( ds, tablename );
- cn.Close();
- }
-
- #endregion
-
- #region ExecuteDataReader
-
- /// <summary>
- /// Executes a single command against a MySQL database, possibly inside an existing transaction.
- /// </summary>
- /// <param name="connection"><see cref="MySqlConnection"/> object to use for the command</param>
- /// <param name="transaction"><see cref="MySqlTransaction"/> object to use for the command</param>
- /// <param name="commandText">Command text to use</param>
- /// <param name="commandParameters">Array of <see cref="MySqlParameter"/> objects to use with the command</param>
- /// <param name="ExternalConn">True if the connection should be preserved, false if not</param>
- /// <returns><see cref="MySqlDataReader"/> object ready to read the results of the command</returns>
- private static MySqlDataReader ExecuteReader(MySqlConnection connection, MySqlTransaction transaction, string commandText, MySqlParameter[] commandParameters, bool ExternalConn )
- {
- //create a command and prepare it for execution
- MySqlCommand cmd = new MySqlCommand();
- cmd.Connection = connection;
- cmd.Transaction = transaction;
- cmd.CommandText = commandText;
- cmd.CommandType = CommandType.Text;
-
- if (commandParameters != null)
- foreach (MySqlParameter p in commandParameters)
- cmd.Parameters.Add( p );
-
- //create a reader
- MySqlDataReader dr;
-
- // call ExecuteReader with the appropriate CommandBehavior
- if (ExternalConn)
- {
- dr = cmd.ExecuteReader();
- }
- else
- {
- dr = cmd.ExecuteReader(CommandBehavior.CloseConnection);
- }
-
- // detach the SqlParameters from the command object, so they can be used again.
- cmd.Parameters.Clear();
-
- return dr;
- }
-
- /// <summary>
- /// Executes a single command against a MySQL database.
- /// </summary>
- /// <param name="connectionString">Settings to use for this command</param>
- /// <param name="commandText">Command text to use</param>
- /// <returns><see cref="MySqlDataReader"/> object ready to read the results of the command</returns>
- public static MySqlDataReader ExecuteReader(string connectionString, string commandText)
- {
- //pass through the call providing null for the set of SqlParameters
- return ExecuteReader(connectionString, commandText, (MySqlParameter[])null);
- }
-
- /// <summary>
- /// Executes a single command against a MySQL database.
- /// </summary>
- /// <param name="connectionString">Settings to use for this command</param>
- /// <param name="commandText">Command text to use</param>
- /// <param name="commandParameters">Array of <see cref="MySqlParameter"/> objects to use with the command</param>
- /// <returns><see cref="MySqlDataReader"/> object ready to read the results of the command</returns>
- public static MySqlDataReader ExecuteReader(string connectionString, string commandText, params MySqlParameter[] commandParameters)
- {
- //create & open a SqlConnection
- MySqlConnection cn = new MySqlConnection(connectionString);
- cn.Open();
-
- try
- {
- //call the private overload that takes an internally owned connection in place of the connection string
- return ExecuteReader(cn, null, commandText, commandParameters, false );
- }
- catch
- {
- //if we fail to return the SqlDatReader, we need to close the connection ourselves
- cn.Close();
- throw;
- }
- }
- #endregion
-
- #region ExecuteScalar
-
- /// <summary>
- /// Execute a single command against a MySQL database.
- /// </summary>
- /// <param name="connectionString">Settings to use for the update</param>
- /// <param name="commandText">Command text to use for the update</param>
- /// <returns>The first column of the first row in the result set, or a null reference if the result set is empty.</returns>
- public static object ExecuteScalar(string connectionString, string commandText)
- {
- //pass through the call providing null for the set of MySqlParameters
- return ExecuteScalar(connectionString, commandText, (MySqlParameter[])null);
- }
-
- /// <summary>
- /// Execute a single command against a MySQL database.
- /// </summary>
- /// <param name="connectionString">Settings to use for the command</param>
- /// <param name="commandText">Command text to use for the command</param>
- /// <param name="commandParameters">Parameters to use for the command</param>
- /// <returns>The first column of the first row in the result set, or a null reference if the result set is empty.</returns>
- public static object ExecuteScalar(string connectionString, string commandText, params MySqlParameter[] commandParameters)
- {
- //create & open a SqlConnection, and dispose of it after we are done.
- using (MySqlConnection cn = new MySqlConnection(connectionString))
- {
- cn.Open();
-
- //call the overload that takes a connection in place of the connection string
- return ExecuteScalar(cn, commandText, commandParameters);
- }
- }
-
- /// <summary>
- /// Execute a single command against a MySQL database.
- /// </summary>
- /// <param name="connection"><see cref="MySqlConnection"/> object to use</param>
- /// <param name="commandText">Command text to use for the command</param>
- /// <returns>The first column of the first row in the result set, or a null reference if the result set is empty.</returns>
- public static object ExecuteScalar(MySqlConnection connection, string commandText)
- {
- //pass through the call providing null for the set of MySqlParameters
- return ExecuteScalar(connection, commandText, (MySqlParameter[])null);
- }
-
- /// <summary>
- /// Execute a single command against a MySQL database.
- /// </summary>
- /// <param name="connection"><see cref="MySqlConnection"/> object to use</param>
- /// <param name="commandText">Command text to use for the command</param>
- /// <param name="commandParameters">Parameters to use for the command</param>
- /// <returns>The first column of the first row in the result set, or a null reference if the result set is empty.</returns>
- public static object ExecuteScalar(MySqlConnection connection, string commandText, params MySqlParameter[] commandParameters)
- {
- //create a command and prepare it for execution
- MySqlCommand cmd = new MySqlCommand();
- cmd.Connection = connection;
- cmd.CommandText = commandText;
- cmd.CommandType = CommandType.Text;
-
- if (commandParameters != null)
- foreach (MySqlParameter p in commandParameters)
- cmd.Parameters.Add( p );
-
- //execute the command & return the results
- object retval = cmd.ExecuteScalar();
-
- // detach the SqlParameters from the command object, so they can be used again.
- cmd.Parameters.Clear();
- return retval;
-
- }
-
- #endregion
- }
-}
+using System;\r
+using System.Data;\r
+using ByteFX.Data.MySqlClient;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Helper class that makes it easier to work with the provider.\r
+ /// </summary>\r
+ public sealed class MySqlHelper\r
+ {\r
+ // this class provides only static methods\r
+ private MySqlHelper()\r
+ {\r
+ }\r
+\r
+ #region ExecuteNonQuery\r
+\r
+ /// <summary>\r
+ /// Executes a single command against a MySQL database. The <see cref="MySqlConnection"/> is assumed to be\r
+ /// open when the method is called and remains open after the method completes.\r
+ /// </summary>\r
+ /// <param name="connection"><see cref="MySqlConnection"/> object to use</param>\r
+ /// <param name="commandText">SQL command to be executed</param>\r
+ /// <param name="commandParameters">Array of <see cref="MySqlParameter"/> objects to use with the command.</param>\r
+ /// <returns></returns>\r
+ public static int ExecuteNonQuery( MySqlConnection connection, string commandText, params MySqlParameter[] commandParameters )\r
+ {\r
+ //create a command and prepare it for execution\r
+ MySqlCommand cmd = new MySqlCommand();\r
+ cmd.Connection = connection;\r
+ cmd.CommandText = commandText;\r
+ cmd.CommandType = CommandType.Text;\r
+\r
+ if (commandParameters != null)\r
+ foreach (MySqlParameter p in commandParameters)\r
+ cmd.Parameters.Add( p );\r
+\r
+ int result = cmd.ExecuteNonQuery();\r
+ cmd.Parameters.Clear();\r
+\r
+ return result;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Executes a single command against a MySQL database. A new <see cref="MySqlConnection"/> is created\r
+ /// using the <see cref="MySqlConnection.ConnectionString"/> given.\r
+ /// </summary>\r
+ /// <param name="connectionString"><see cref="MySqlConnection.ConnectionString"/> to use</param>\r
+ /// <param name="commandText">SQL command to be executed</param>\r
+ /// <param name="parms">Array of <see cref="MySqlParameter"/> objects to use with the command.</param>\r
+ /// <returns></returns>\r
+ public static int ExecuteNonQuery( string connectionString, string commandText, params MySqlParameter[] parms )\r
+ {\r
+ //create & open a SqlConnection, and dispose of it after we are done.\r
+ using (MySqlConnection cn = new MySqlConnection(connectionString))\r
+ {\r
+ cn.Open();\r
+\r
+ //call the overload that takes a connection in place of the connection string\r
+ return ExecuteNonQuery(cn, commandText, parms );\r
+ }\r
+ }\r
+ #endregion\r
+\r
+ #region ExecuteDataSet\r
+\r
+ /// <summary>\r
+ /// Executes a single SQL command and returns the first row of the resultset. A new MySqlConnection object\r
+ /// is created, opened, and closed during this method.\r
+ /// </summary>\r
+ /// <param name="connectionString">Settings to be used for the connection</param>\r
+ /// <param name="commandText">Command to execute</param>\r
+ /// <param name="parms">Parameters to use for the command</param>\r
+ /// <returns>DataRow containing the first row of the resultset</returns>\r
+ public static DataRow ExecuteDatarow( string connectionString, string commandText, params MySqlParameter[] parms )\r
+ {\r
+ DataSet ds = ExecuteDataset( connectionString, commandText, parms );\r
+ if (ds == null) return null;\r
+ if (ds.Tables.Count == 0) return null;\r
+ if (ds.Tables[0].Rows.Count == 0) return null;\r
+ return ds.Tables[0].Rows[0];\r
+ }\r
+\r
+ /// <summary>\r
+ /// Executes a single SQL command and returns the resultset in a <see cref="DataSet"/>. \r
+ /// A new MySqlConnection object is created, opened, and closed during this method.\r
+ /// </summary>\r
+ /// <param name="connectionString">Settings to be used for the connection</param>\r
+ /// <param name="commandText">Command to execute</param>\r
+ /// <returns><see cref="DataSet"/> containing the resultset</returns>\r
+ public static DataSet ExecuteDataset(string connectionString, string commandText)\r
+ {\r
+ //pass through the call providing null for the set of SqlParameters\r
+ return ExecuteDataset(connectionString, commandText, (MySqlParameter[])null);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Executes a single SQL command and returns the resultset in a <see cref="DataSet"/>. \r
+ /// A new MySqlConnection object is created, opened, and closed during this method.\r
+ /// </summary>\r
+ /// <param name="connectionString">Settings to be used for the connection</param>\r
+ /// <param name="commandText">Command to execute</param>\r
+ /// <param name="commandParameters">Parameters to use for the command</param>\r
+ /// <returns><see cref="DataSet"/> containing the resultset</returns>\r
+ public static DataSet ExecuteDataset(string connectionString, string commandText, params MySqlParameter[] commandParameters)\r
+ {\r
+ //create & open a SqlConnection, and dispose of it after we are done.\r
+ using (MySqlConnection cn = new MySqlConnection(connectionString))\r
+ {\r
+ cn.Open();\r
+\r
+ //call the overload that takes a connection in place of the connection string\r
+ return ExecuteDataset(cn, commandText, commandParameters);\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Executes a single SQL command and returns the resultset in a <see cref="DataSet"/>. \r
+ /// The state of the <see cref="MySqlConnection"/> object remains unchanged after execution\r
+ /// of this method.\r
+ /// </summary>\r
+ /// <param name="connection"><see cref="MySqlConnection"/> object to use</param>\r
+ /// <param name="commandText">Command to execute</param>\r
+ /// <returns><see cref="DataSet"/> containing the resultset</returns>\r
+ public static DataSet ExecuteDataset(MySqlConnection connection, string commandText)\r
+ {\r
+ //pass through the call providing null for the set of SqlParameters\r
+ return ExecuteDataset(connection, commandText, (MySqlParameter[])null);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Executes a single SQL command and returns the resultset in a <see cref="DataSet"/>. \r
+ /// The state of the <see cref="MySqlConnection"/> object remains unchanged after execution\r
+ /// of this method.\r
+ /// </summary>\r
+ /// <param name="connection"><see cref="MySqlConnection"/> object to use</param>\r
+ /// <param name="commandText">Command to execute</param>\r
+ /// <param name="commandParameters">Parameters to use for the command</param>\r
+ /// <returns><see cref="DataSet"/> containing the resultset</returns>\r
+ public static DataSet ExecuteDataset(MySqlConnection connection, string commandText, params MySqlParameter[] commandParameters)\r
+ {\r
+ //create a command and prepare it for execution\r
+ MySqlCommand cmd = new MySqlCommand();\r
+ cmd.Connection = connection;\r
+ cmd.CommandText = commandText;\r
+ cmd.CommandType = CommandType.Text;\r
+\r
+ if (commandParameters != null)\r
+ foreach (MySqlParameter p in commandParameters)\r
+ cmd.Parameters.Add( p );\r
+ \r
+ //create the DataAdapter & DataSet\r
+ MySqlDataAdapter da = new MySqlDataAdapter(cmd);\r
+ DataSet ds = new DataSet();\r
+\r
+ //fill the DataSet using default values for DataTable names, etc.\r
+ da.Fill(ds);\r
+ \r
+ // detach the MySqlParameters from the command object, so they can be used again. \r
+ cmd.Parameters.Clear();\r
+ \r
+ //return the dataset\r
+ return ds; \r
+ }\r
+\r
+ /// <summary>\r
+ /// Updates the given table with data from the given <see cref="DataSet"/>\r
+ /// </summary>\r
+ /// <param name="connectionString">Settings to use for the update</param>\r
+ /// <param name="commandText">Command text to use for the update</param>\r
+ /// <param name="ds"><see cref="DataSet"/> containing the new data to use in the update</param>\r
+ /// <param name="tablename">Tablename in the dataset to update</param>\r
+ public static void UpdateDataSet( string connectionString, string commandText, DataSet ds, string tablename )\r
+ {\r
+ MySqlConnection cn = new MySqlConnection( connectionString );\r
+ cn.Open();\r
+ MySqlDataAdapter da = new MySqlDataAdapter( commandText, cn );\r
+ MySqlCommandBuilder cb = new MySqlCommandBuilder( da );\r
+ da.Update( ds, tablename );\r
+ cn.Close();\r
+ }\r
+\r
+ #endregion\r
+\r
+ #region ExecuteDataReader\r
+\r
+ /// <summary>\r
+ /// Executes a single command against a MySQL database, possibly inside an existing transaction.\r
+ /// </summary>\r
+ /// <param name="connection"><see cref="MySqlConnection"/> object to use for the command</param>\r
+ /// <param name="transaction"><see cref="MySqlTransaction"/> object to use for the command</param>\r
+ /// <param name="commandText">Command text to use</param>\r
+ /// <param name="commandParameters">Array of <see cref="MySqlParameter"/> objects to use with the command</param>\r
+ /// <param name="ExternalConn">True if the connection should be preserved, false if not</param>\r
+ /// <returns><see cref="MySqlDataReader"/> object ready to read the results of the command</returns>\r
+ private static MySqlDataReader ExecuteReader(MySqlConnection connection, MySqlTransaction transaction, string commandText, MySqlParameter[] commandParameters, bool ExternalConn )\r
+ { \r
+ //create a command and prepare it for execution\r
+ MySqlCommand cmd = new MySqlCommand();\r
+ cmd.Connection = connection;\r
+ cmd.Transaction = transaction;\r
+ cmd.CommandText = commandText;\r
+ cmd.CommandType = CommandType.Text;\r
+ \r
+ if (commandParameters != null)\r
+ foreach (MySqlParameter p in commandParameters)\r
+ cmd.Parameters.Add( p );\r
+\r
+ //create a reader\r
+ MySqlDataReader dr;\r
+\r
+ // call ExecuteReader with the appropriate CommandBehavior\r
+ if (ExternalConn)\r
+ {\r
+ dr = cmd.ExecuteReader();\r
+ }\r
+ else\r
+ {\r
+ dr = cmd.ExecuteReader(CommandBehavior.CloseConnection);\r
+ }\r
+ \r
+ // detach the SqlParameters from the command object, so they can be used again.\r
+ cmd.Parameters.Clear();\r
+ \r
+ return dr;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Executes a single command against a MySQL database.\r
+ /// </summary>\r
+ /// <param name="connectionString">Settings to use for this command</param>\r
+ /// <param name="commandText">Command text to use</param>\r
+ /// <returns><see cref="MySqlDataReader"/> object ready to read the results of the command</returns>\r
+ public static MySqlDataReader ExecuteReader(string connectionString, string commandText)\r
+ {\r
+ //pass through the call providing null for the set of SqlParameters\r
+ return ExecuteReader(connectionString, commandText, (MySqlParameter[])null);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Executes a single command against a MySQL database.\r
+ /// </summary>\r
+ /// <param name="connectionString">Settings to use for this command</param>\r
+ /// <param name="commandText">Command text to use</param>\r
+ /// <param name="commandParameters">Array of <see cref="MySqlParameter"/> objects to use with the command</param>\r
+ /// <returns><see cref="MySqlDataReader"/> object ready to read the results of the command</returns>\r
+ public static MySqlDataReader ExecuteReader(string connectionString, string commandText, params MySqlParameter[] commandParameters)\r
+ {\r
+ //create & open a SqlConnection\r
+ MySqlConnection cn = new MySqlConnection(connectionString);\r
+ cn.Open();\r
+\r
+ try\r
+ {\r
+ //call the private overload that takes an internally owned connection in place of the connection string\r
+ return ExecuteReader(cn, null, commandText, commandParameters, false );\r
+ }\r
+ catch\r
+ {\r
+ //if we fail to return the SqlDatReader, we need to close the connection ourselves\r
+ cn.Close();\r
+ throw;\r
+ }\r
+ }\r
+ #endregion\r
+\r
+ #region ExecuteScalar\r
+\r
+ /// <summary>\r
+ /// Execute a single command against a MySQL database.\r
+ /// </summary>\r
+ /// <param name="connectionString">Settings to use for the update</param>\r
+ /// <param name="commandText">Command text to use for the update</param>\r
+ /// <returns>The first column of the first row in the result set, or a null reference if the result set is empty.</returns>\r
+ public static object ExecuteScalar(string connectionString, string commandText)\r
+ {\r
+ //pass through the call providing null for the set of MySqlParameters\r
+ return ExecuteScalar(connectionString, commandText, (MySqlParameter[])null);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Execute a single command against a MySQL database.\r
+ /// </summary>\r
+ /// <param name="connectionString">Settings to use for the command</param>\r
+ /// <param name="commandText">Command text to use for the command</param>\r
+ /// <param name="commandParameters">Parameters to use for the command</param>\r
+ /// <returns>The first column of the first row in the result set, or a null reference if the result set is empty.</returns>\r
+ public static object ExecuteScalar(string connectionString, string commandText, params MySqlParameter[] commandParameters)\r
+ {\r
+ //create & open a SqlConnection, and dispose of it after we are done.\r
+ using (MySqlConnection cn = new MySqlConnection(connectionString))\r
+ {\r
+ cn.Open();\r
+\r
+ //call the overload that takes a connection in place of the connection string\r
+ return ExecuteScalar(cn, commandText, commandParameters);\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Execute a single command against a MySQL database.\r
+ /// </summary>\r
+ /// <param name="connection"><see cref="MySqlConnection"/> object to use</param>\r
+ /// <param name="commandText">Command text to use for the command</param>\r
+ /// <returns>The first column of the first row in the result set, or a null reference if the result set is empty.</returns>\r
+ public static object ExecuteScalar(MySqlConnection connection, string commandText)\r
+ {\r
+ //pass through the call providing null for the set of MySqlParameters\r
+ return ExecuteScalar(connection, commandText, (MySqlParameter[])null);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Execute a single command against a MySQL database.\r
+ /// </summary>\r
+ /// <param name="connection"><see cref="MySqlConnection"/> object to use</param>\r
+ /// <param name="commandText">Command text to use for the command</param>\r
+ /// <param name="commandParameters">Parameters to use for the command</param>\r
+ /// <returns>The first column of the first row in the result set, or a null reference if the result set is empty.</returns>\r
+ public static object ExecuteScalar(MySqlConnection connection, string commandText, params MySqlParameter[] commandParameters)\r
+ {\r
+ //create a command and prepare it for execution\r
+ MySqlCommand cmd = new MySqlCommand();\r
+ cmd.Connection = connection;\r
+ cmd.CommandText = commandText;\r
+ cmd.CommandType = CommandType.Text;\r
+ \r
+ if (commandParameters != null)\r
+ foreach (MySqlParameter p in commandParameters)\r
+ cmd.Parameters.Add( p );\r
+ \r
+ //execute the command & return the results\r
+ object retval = cmd.ExecuteScalar();\r
+ \r
+ // detach the SqlParameters from the command object, so they can be used again.\r
+ cmd.Parameters.Clear();\r
+ return retval;\r
+ \r
+ }\r
+\r
+ #endregion\r
+ }\r
+}\r
-using System;
-using ByteFX.Data.Common;
-using System.Collections;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Summary description for MySqlPool.
- /// </summary>
- internal sealed class MySqlPool
- {
- private ArrayList inUsePool;
- private ArrayList idlePool;
- private MySqlConnectionString settings;
- private int minSize;
- private int maxSize;
-
- public MySqlPool(MySqlConnectionString settings)
- {
- minSize = settings.MinPoolSize;
- maxSize = settings.MaxPoolSize;
- this.settings = settings;
- inUsePool =new ArrayList();
- idlePool = new ArrayList( settings.MinPoolSize );
-
- // prepopulate the idle pool to minSize
- for (int i=0; i < minSize; i++)
- CreateNewPooledConnection();
- }
-
- private void CheckOutConnection(MySqlInternalConnection conn)
- {
- }
-
- private MySqlInternalConnection GetPooledConnection()
- {
- MySqlInternalConnection conn = null;
-
- // if there are no idle connections and the in use pool is full
- // then return null to indicate that we cannot provide a connection
- // at this time.
- if (idlePool.Count == 0 && inUsePool.Count == maxSize) return null;
-
- lock (idlePool.SyncRoot)
- {
- for (int i=idlePool.Count-1; i >=0; i--)
- {
- conn = (idlePool[i] as MySqlInternalConnection);
- if (conn.IsAlive())
- {
- lock (inUsePool)
- {
- inUsePool.Add( conn );
- }
- idlePool.RemoveAt( i );
- return conn;
- }
- else
- {
- conn.Close();
- idlePool.RemoveAt(i);
- }
- }
- }
-
- // if we couldn't get a pooled connection and there is still room
- // make a new one
- if (conn == null && (idlePool.Count+inUsePool.Count) < maxSize)
- {
- conn = CreateNewPooledConnection();
- if (conn == null) return null;
-
- lock (idlePool.SyncRoot)
- lock (inUsePool.SyncRoot)
- {
- idlePool.Remove( conn );
- inUsePool.Add( conn );
- }
- }
-
- return conn;
- }
-
- private MySqlInternalConnection CreateNewPooledConnection()
- {
- lock(idlePool.SyncRoot)
- lock (inUsePool.SyncRoot)
- {
- // first we check if we are allowed to create another
- if ((inUsePool.Count + idlePool.Count) == maxSize) return null;
-
- MySqlInternalConnection conn = new MySqlInternalConnection( settings );
- conn.Open();
- idlePool.Add( conn );
- return conn;
- }
- }
-
- public void ReleaseConnection( MySqlInternalConnection connection )
- {
- lock (idlePool.SyncRoot)
- lock (inUsePool.SyncRoot)
- {
- inUsePool.Remove( connection );
- if (connection.Settings.ConnectionLifetime != 0 && connection.IsTooOld())
- connection.Close();
- else
- idlePool.Add( connection );
- }
- }
-
- public MySqlInternalConnection GetConnection()
- {
- MySqlInternalConnection conn = null;
-
- int start = Environment.TickCount;
- int ticks = settings.ConnectTimeout * 1000;
-
- // wait timeOut seconds at most to get a connection
- while (conn == null && (Environment.TickCount - start) < ticks)
- conn = GetPooledConnection();
-
- // if pool size is at maximum, then we must have reached our timeout so we simply
- // throw our exception
- if (conn == null)
- throw new MySqlException("error connecting: Timeout expired. The timeout period elapsed " +
- "prior to obtaining a connection from the pool. This may have occurred because all " +
- "pooled connections were in use and max pool size was reached.");
-
- return conn;
- }
-
- }
-}
+using System;\r
+using ByteFX.Data.Common;\r
+using System.Collections;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Summary description for MySqlPool.\r
+ /// </summary>\r
+ internal sealed class MySqlPool\r
+ {\r
+ private ArrayList inUsePool;\r
+ private ArrayList idlePool;\r
+ private MySqlConnectionString settings;\r
+ private int minSize;\r
+ private int maxSize;\r
+\r
+ public MySqlPool(MySqlConnectionString settings)\r
+ {\r
+ minSize = settings.MinPoolSize;\r
+ maxSize = settings.MaxPoolSize;\r
+ this.settings = settings;\r
+ inUsePool =new ArrayList();\r
+ idlePool = new ArrayList( settings.MinPoolSize );\r
+\r
+ // prepopulate the idle pool to minSize\r
+ for (int i=0; i < minSize; i++) \r
+ CreateNewPooledConnection();\r
+ }\r
+\r
+ private void CheckOutConnection(MySqlInternalConnection conn) \r
+ {\r
+ }\r
+\r
+ private MySqlInternalConnection GetPooledConnection()\r
+ {\r
+ MySqlInternalConnection conn = null;\r
+\r
+ // if there are no idle connections and the in use pool is full\r
+ // then return null to indicate that we cannot provide a connection\r
+ // at this time.\r
+ if (idlePool.Count == 0 && inUsePool.Count == maxSize) return null;\r
+\r
+ lock (idlePool.SyncRoot) \r
+ {\r
+ for (int i=idlePool.Count-1; i >=0; i--)\r
+ {\r
+ conn = (idlePool[i] as MySqlInternalConnection);\r
+ if (conn.IsAlive()) \r
+ {\r
+ lock (inUsePool) \r
+ {\r
+ inUsePool.Add( conn );\r
+ }\r
+ idlePool.RemoveAt( i );\r
+ return conn;\r
+ }\r
+ else \r
+ {\r
+ conn.Close();\r
+ idlePool.RemoveAt(i);\r
+ conn = null;\r
+ }\r
+ }\r
+ }\r
+\r
+ // if we couldn't get a pooled connection and there is still room\r
+ // make a new one\r
+ if (conn == null && (idlePool.Count+inUsePool.Count) < maxSize)\r
+ {\r
+ conn = CreateNewPooledConnection();\r
+ if (conn == null) return null;\r
+\r
+ lock (idlePool.SyncRoot)\r
+ lock (inUsePool.SyncRoot) \r
+ {\r
+ idlePool.Remove( conn );\r
+ inUsePool.Add( conn );\r
+ }\r
+ }\r
+\r
+ return conn;\r
+ }\r
+\r
+ private MySqlInternalConnection CreateNewPooledConnection()\r
+ {\r
+ lock(idlePool.SyncRoot) \r
+ lock (inUsePool.SyncRoot)\r
+ {\r
+ // first we check if we are allowed to create another\r
+ if ((inUsePool.Count + idlePool.Count) == maxSize) return null;\r
+\r
+ MySqlInternalConnection conn = new MySqlInternalConnection( settings );\r
+ conn.Open();\r
+ idlePool.Add( conn );\r
+ return conn;\r
+ }\r
+ }\r
+\r
+ public void ReleaseConnection( MySqlInternalConnection connection )\r
+ {\r
+ lock (idlePool.SyncRoot)\r
+ lock (inUsePool.SyncRoot) \r
+ {\r
+ inUsePool.Remove( connection );\r
+ if (connection.Settings.ConnectionLifetime != 0 && connection.IsTooOld())\r
+ connection.Close();\r
+ else\r
+ idlePool.Add( connection );\r
+ }\r
+ }\r
+\r
+ public MySqlInternalConnection GetConnection() \r
+ {\r
+ MySqlInternalConnection conn = null;\r
+\r
+ int start = Environment.TickCount;\r
+ int ticks = settings.ConnectionTimeout * 1000;\r
+\r
+ // wait timeOut seconds at most to get a connection\r
+ while (conn == null && (Environment.TickCount - start) < ticks)\r
+ conn = GetPooledConnection();\r
+ \r
+ // if pool size is at maximum, then we must have reached our timeout so we simply\r
+ // throw our exception\r
+ if (conn == null)\r
+ throw new MySqlException("error connecting: Timeout expired. The timeout period elapsed " + \r
+ "prior to obtaining a connection from the pool. This may have occurred because all " +\r
+ "pooled connections were in use and max pool size was reached.");\r
+\r
+ return conn;\r
+ }\r
+\r
+ }\r
+}\r
-using System;
-using ByteFX.Data.Common;
-using System.Collections;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Summary description for MySqlPoolManager.
- /// </summary>
- internal sealed class MySqlPoolManager
- {
- private static Hashtable pools;
-
- public MySqlPoolManager()
- {
- }
-
- /// <summary>
- ///
- /// </summary>
- private static void Initialize()
- {
- pools = new Hashtable();
- }
-
- public static MySqlInternalConnection GetConnection( MySqlConnectionString settings )
- {
- // make sure the manager is initialized
- if (MySqlPoolManager.pools == null)
- MySqlPoolManager.Initialize();
-
- string text = settings.ConnectString;
-
- lock( pools.SyncRoot )
- {
- MySqlPool pool;
- if (!pools.Contains( text ))
- {
- pool = new MySqlPool( settings );
- pools.Add( text, pool );
- }
- else
- {
- pool = (pools[text] as MySqlPool);
- }
-
- return pool.GetConnection();
- }
- }
-
- public static void ReleaseConnection( MySqlInternalConnection connection )
- {
- lock (pools.SyncRoot)
- {
- string key = connection.Settings.ConnectString;
- MySqlPool pool = (MySqlPool)pools[ key ];
- if (pool == null)
- throw new MySqlException("Pooling exception: Unable to find original pool for connection");
- pool.ReleaseConnection(connection);
- }
- }
- }
-}
+using System;\r
+using ByteFX.Data.Common;\r
+using System.Collections;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Summary description for MySqlPoolManager.\r
+ /// </summary>\r
+ internal sealed class MySqlPoolManager\r
+ {\r
+ private static Hashtable pools;\r
+\r
+ public MySqlPoolManager() \r
+ {\r
+ }\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ private static void Initialize()\r
+ {\r
+ pools = new Hashtable();\r
+ }\r
+\r
+ public static MySqlInternalConnection GetConnection( MySqlConnectionString settings ) \r
+ {\r
+ // make sure the manager is initialized\r
+ if (MySqlPoolManager.pools == null)\r
+ MySqlPoolManager.Initialize();\r
+\r
+ string text = settings.GetConnectionString();\r
+\r
+ lock( pools.SyncRoot ) \r
+ {\r
+ MySqlPool pool;\r
+ if (!pools.Contains( text )) \r
+ {\r
+ pool = new MySqlPool( settings );\r
+ pools.Add( text, pool );\r
+ }\r
+ else \r
+ {\r
+ pool = (pools[text] as MySqlPool);\r
+ }\r
+\r
+ return pool.GetConnection();\r
+ }\r
+ }\r
+\r
+ public static void ReleaseConnection( MySqlInternalConnection connection )\r
+ {\r
+ lock (pools.SyncRoot) \r
+ {\r
+ string key = connection.Settings.GetConnectionString();\r
+ MySqlPool pool = (MySqlPool)pools[ key ];\r
+ if (pool == null)\r
+ throw new MySqlException("Pooling exception: Unable to find original pool for connection");\r
+ pool.ReleaseConnection(connection);\r
+ }\r
+ }\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.IO;
-using System.Net;
-using System.Net.Sockets;
-using ByteFX.Data.Common;
-using System.Threading;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Summary description for API.
- /// </summary>
- internal class MySqlStream : MultiHostStream
- {
- public MySqlStream( string hostList, int port, int readTimeOut, int connectTimeOut ) :
- base( hostList, port, readTimeOut, connectTimeOut )
-
- {
- }
-
- protected override void Error(string msg)
- {
- throw new MySqlException( msg, baseException );
- }
-
- protected override void TimeOut(MultiHostStreamErrorType error)
- {
- switch (error)
- {
- case MultiHostStreamErrorType.Connecting:
- throw new MySqlException("Timed out creating a new MySqlConnection");
- case MultiHostStreamErrorType.Reading:
- throw new MySqlException("Timed out reading from MySql");
- }
- }
-
- protected override bool CreateStream( IPAddress ip, string hostname, int port )
- {
- if (port == -1)
- return CreatePipeStream(ip, hostname);
- else
- return CreateSocketStream(ip, port);
- }
-
- private bool CreatePipeStream( IPAddress ip, string hostname )
- {
- string pipeName;
-
- if (hostname.ToLower().Equals("localhost"))
- pipeName = @"\\.\pipe\MySql";
- else
- pipeName = String.Format(@"\\{0}\pipe\MySql", ip.ToString());
-
- try
- {
- stream = new NamedPipeStream(pipeName, FileAccess.ReadWrite);
- return true;
- }
- catch (Exception ex)
- {
- baseException = ex;
- return false;
- }
- }
-
- private bool CreateSocketStream( IPAddress ip, int port )
- {
- Socket socket = new Socket(AddressFamily.InterNetwork,
- SocketType.Stream, ProtocolType.Tcp);
-
- try
- {
- //
- // Lets try to connect
- IPEndPoint endPoint = new IPEndPoint( ip, port);
- socket.Connect(endPoint);
- socket.SetSocketOption( SocketOptionLevel.Tcp, SocketOptionName.NoDelay, 1 );
- stream = new NetworkStream( socket, true );
- return true;
- }
- catch (Exception ex)
- {
- baseException = ex;
- return false;
- }
- }
-
- protected override bool DataAvailable
- {
- get
- {
- if (stream is NetworkStream)
- return ((NetworkStream)stream).DataAvailable;
- else return (stream as NamedPipeStream).DataAvailable;
- }
- }
-
- public int ReadInt24()
- {
- byte[] bytes = new byte[3];
- Read( bytes, 0, 3 );
- return (bytes[0] + (bytes[1]*256) + (bytes[2]*256*256));
- }
-
- public override void Close()
- {
- stream.Close();
- }
-
- }
-}
-
-
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+// Copyright (C) 2003 PT Cakram Datalingga Duaribu (http://www.cdl2000.com)\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.IO;\r
+using System.Net;\r
+using System.Net.Sockets;\r
+using ByteFX.Data.Common;\r
+using System.Threading;\r
+#if __MonoCS__ \r
+using Mono.Posix;\r
+#endif\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Summary description for API.\r
+ /// </summary>\r
+ internal class MySqlStream : MultiHostStream\r
+ {\r
+ private Socket socket;\r
+\r
+ public MySqlStream( string hostList, int port, int readTimeOut, int connectTimeOut ) :\r
+ base( hostList, port, readTimeOut, connectTimeOut )\r
+\r
+ {\r
+ }\r
+\r
+ protected override void Error(string msg)\r
+ {\r
+ throw new MySqlException( msg, baseException );\r
+ }\r
+\r
+ protected override void TimeOut(MultiHostStreamErrorType error) \r
+ {\r
+ switch (error) \r
+ {\r
+ case MultiHostStreamErrorType.Connecting:\r
+ throw new MySqlException("Timed out creating a new MySqlConnection");\r
+ case MultiHostStreamErrorType.Reading:\r
+ throw new MySqlException("Timed out reading from MySql");\r
+ }\r
+ }\r
+\r
+ protected override bool CreateStream( IPAddress ip, string hostname, int port )\r
+ {\r
+ if (port == -1)\r
+ return CreatePipeStream(ip, hostname);\r
+ else\r
+ return CreateSocketStream(ip, port);\r
+ }\r
+\r
+ protected override bool CreateStream (string filename)\r
+ {\r
+ return CreateUnixSocketStream (filename);\r
+ }\r
+\r
+ private bool CreatePipeStream( IPAddress ip, string hostname )\r
+ {\r
+ string pipeName;\r
+\r
+ if (hostname.ToLower().Equals("localhost"))\r
+ pipeName = @"\\.\pipe\MySql";\r
+ else\r
+ pipeName = String.Format(@"\\{0}\pipe\MySql", ip.ToString());\r
+\r
+ try \r
+ {\r
+ stream = new NamedPipeStream(pipeName, FileAccess.ReadWrite);\r
+ return true;\r
+ }\r
+ catch (Exception ex) \r
+ {\r
+ baseException = ex;\r
+ return false;\r
+ }\r
+ }\r
+\r
+ private bool CreateSocketStream( IPAddress ip, int port )\r
+ {\r
+ socket = new Socket(AddressFamily.InterNetwork, \r
+ SocketType.Stream, ProtocolType.Tcp);\r
+\r
+ try\r
+ {\r
+ //\r
+ // Lets try to connect\r
+ IPEndPoint endPoint = new IPEndPoint( ip, port);\r
+ socket.Connect(endPoint);\r
+ socket.SetSocketOption( SocketOptionLevel.Tcp, SocketOptionName.NoDelay, 1 );\r
+ stream = new NetworkStream( socket, true );\r
+ socket.Blocking = false;\r
+ return true;\r
+ }\r
+ catch (Exception ex)\r
+ {\r
+ baseException = ex;\r
+ return false;\r
+ }\r
+ }\r
+\r
+ private bool CreateUnixSocketStream(string socketName)\r
+ {\r
+#if __MonoCS__ && !WINDOWS\r
+ Socket socket = new Socket (AddressFamily.Unix, SocketType.Stream, ProtocolType.IP);\r
+\r
+ try\r
+ {\r
+ UnixEndPoint endPoint = new UnixEndPoint (socketName);\r
+ socket.Connect (endPoint);\r
+ stream = new NetworkStream (socket, true);\r
+ return true;\r
+ }\r
+ catch (Exception ex)\r
+ {\r
+ baseException = ex;\r
+ return false;\r
+ }\r
+#else\r
+ baseException = new PlatformNotSupportedException ("This is not a Unix");\r
+ return false;\r
+#endif\r
+ }\r
+\r
+ protected override bool DataAvailable\r
+ {\r
+ get \r
+ {\r
+ if (stream is NetworkStream)\r
+ return ((NetworkStream)stream).DataAvailable;\r
+ else return (stream as NamedPipeStream).DataAvailable;\r
+ }\r
+ }\r
+\r
+ public int ReadInt24()\r
+ {\r
+ byte[] bytes = new byte[3];\r
+ Read( bytes, 0, 3 );\r
+ return (bytes[0] + (bytes[1]*256) + (bytes[2]*256*256));\r
+ }\r
+\r
+ public override void Close()\r
+ {\r
+ stream.Close();\r
+ }\r
+\r
+ }\r
+}\r
+\r
+\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-using System;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Summary description for ClientParam.
- /// </summary>
- [Flags()]
- internal enum ClientParam
- {
- CLIENT_LONG_PASSWORD = 1, // new more secure passwords
- CLIENT_FOUND_ROWS = 2, // found instead of affected rows
- CLIENT_LONG_FLAG = 4, // Get all column flags
- CLIENT_CONNECT_WITH_DB = 8, // One can specify db on connect
- CLIENT_NO_SCHEMA = 16, // Don't allow db.table.column
- CLIENT_COMPRESS = 32, // Client can use compression protocol
- CLIENT_ODBC = 64, // ODBC client
- CLIENT_LOCAL_FILES = 128, // Can use LOAD DATA LOCAL
- CLIENT_IGNORE_SPACE = 256, // Ignore spaces before '('
- CLIENT_CHANGE_USER = 512, // Support the mysql_change_user()
- CLIENT_INTERACTIVE = 1024, // This is an interactive client
- CLIENT_SSL = 2048, // Switch to SSL after handshake
- CLIENT_IGNORE_SIGPIPE = 4096, // IGNORE sigpipes
- CLIENT_TRANSACTIONS = 8192, // Client knows about transactions
- CLIENT_PROTOCOL_41 = 16384,
- CLIENT_SECURE_CONNECTION = 32768
-
- }
-
-
- /// <summary>
- /// DB Operations Code
- /// </summary>
- internal enum DBCmd : byte
- {
- SLEEP = 0,
- QUIT = 1,
- INIT_DB = 2,
- QUERY = 3,
- FIELD_LIST = 4,
- CREATE_DB = 5,
- DROP_DB = 6,
- RELOAD = 7,
- SHUTDOWN = 8,
- STATISTICS = 9,
- PROCESS_INFO = 10,
- CONNECT = 11,
- PROCESS_KILL = 12,
- DEBUG = 13,
- PING = 14,
- TIME = 15,
- DELAYED_INSERT = 16,
- CHANGE_USER = 17,
- }
-
- /// <summary>
- /// Specifies MySQL specific data type of a field, property, for use in a <see cref="MySqlParameter"/>.
- /// </summary>
- public enum MySqlDbType
- {
- /// <summary> <see cref="Decimal"/><para>A fixed precision and scale numeric value between -1038 -1 and 10 38 -1.</para></summary>
- Decimal = 0,
- /// <summary> <see cref="Byte"/><para>The signed range is -128 to 127. The unsigned range is 0 to 255.</para></summary>
- Byte = 1,
- /// <summary><see cref="Int16"/><para>A 16-bit signed or unsigned integer. The signed range is -32768 to 32767. The unsigned range is 0 to 65535</para></summary>
- Short = 2,
- /// <summary><see cref="Int32"/><para>A 32-bit signed or unsigned integer</para></summary>
- Int = 3,
- /// <summary><b>Obsolete</b> Please use Int for 32 bit values</summary>
- [Obsolete("Long is no longer the correct way of specifying a 32 bit value. Use Int")]
- Long = 3,
- /// <summary><see cref="Single"/><para>A small (single-precision) floating-point number. Allowable values are -3.402823466E+38 to -1.175494351E-38, 0, and 1.175494351E-38 to 3.402823466E+38.</para></summary>
- Float = 4,
- /// <summary><see cref="Double"/><para>A normal-size (double-precision) floating-point number. Allowable values are -1.7976931348623157E+308 to -2.2250738585072014E-308, 0, and 2.2250738585072014E-308 to 1.7976931348623157E+308.</para></summary>
- Double = 5,
- /// <summary>Specifies a null value</summary>
- Null = 6,
- /// <summary>A timestamp. The range is '1970-01-01 00:00:00' to sometime in the year 2037</summary>
- Timestamp = 7,
- /// <summary><see cref="Int64"/><para>A 64-bit signed or unsigned integer.</para></summary>
- BigInt = 8,
- /// <summary><b>Obsolete</b> Please use BigInt for 64 bit values</summary>
- [Obsolete("LongLong is no longer the correct way of specifying a 64 bit value. Use BigInt")]
- LongLong = 8,
- /// <summary>Specifies a 24 (3 byte) signed or unsigned value.</summary>
- Int24 = 9,
- ///<summary>Date The supported range is '1000-01-01' to '9999-12-31'.</summary>
- Date = 10,
- /// <summary> Time <para>The range is '-838:59:59' to '838:59:59'.</para></summary>
- Time = 11,
- ///<summary>DateTime The supported range is '1000-01-01 00:00:00' to '9999-12-31 23:59:59'.</summary>
- Datetime = 12,
- /// <summary>A year in 2- or 4-digit format (default is 4-digit). The allowable values are 1901 to 2155, 0000 in the 4-digit year format, and 1970-2069 if you use the 2-digit format (70-69)</summary>
- Year = 13,
- /// <summary><b>Obsolete</b> Use Datetime or Date type</summary>
- Newdate = 14,
- /// <summary>An enumeration. A string object that can have only one value, chosen from the list of values 'value1', 'value2', ..., NULL or the special "" error value. An ENUM can have a maximum of 65535 distinct values</summary>
- Enum = 247,
- /// <summary>A set. A string object that can have zero or more values, each of which must be chosen from the list of values 'value1', 'value2', ... A SET can have a maximum of 64 members.</summary>
- Set = 248,
- /// <summary>A BLOB or TEXT column with a maximum length of 255 (2^8 - 1) characters</summary>
- TinyBlob = 249,
- /// <summary>A BLOB or TEXT column with a maximum length of 16777215 (2^24 - 1) characters</summary>
- MediumBlob = 250,
- /// <summary>A BLOB or TEXT column with a maximum length of 4294967295 or 4G (2^32 - 1) characters</summary>
- LongBlob = 251,
- /// <summary>A BLOB or TEXT column with a maximum length of 65535 (2^16 - 1) characters</summary>
- Blob = 252,
- /// <summary>A variable-length string containing 0 to 255 characters</summary>
- VarChar = 253,
- /// <summary><b>Obsolete</b> Use VarChar type</summary>
- String = 254
- };
-
-
- enum Field_Type : byte
- {
- DECIMAL =0,
- BYTE =1,
- SHORT =2,
- LONG =3,
- FLOAT =4,
- DOUBLE =5,
- NULL =6,
- TIMESTAMP =7,
- LONGLONG =8,
- INT24 =9,
- DATE =10,
- TIME =11,
- DATETIME =12,
- YEAR =13,
- NEWDATE =14,
- ENUM =247,
- SET =248,
- TINY_BLOB =249,
- MEDIUM_BLOB =250,
- LONG_BLOB =251,
- BLOB =252,
- VAR_STRING =253,
- STRING =254,
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+using System;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Summary description for ClientParam.\r
+ /// </summary>\r
+ [Flags()]\r
+ internal enum ClientParam\r
+ {\r
+ CLIENT_LONG_PASSWORD = 1, // new more secure passwords\r
+ CLIENT_FOUND_ROWS = 2, // found instead of affected rows\r
+ CLIENT_LONG_FLAG = 4, // Get all column flags\r
+ CLIENT_CONNECT_WITH_DB = 8, // One can specify db on connect\r
+ CLIENT_NO_SCHEMA = 16, // Don't allow db.table.column\r
+ CLIENT_COMPRESS = 32, // Client can use compression protocol\r
+ CLIENT_ODBC = 64, // ODBC client\r
+ CLIENT_LOCAL_FILES = 128, // Can use LOAD DATA LOCAL\r
+ CLIENT_IGNORE_SPACE = 256, // Ignore spaces before '('\r
+ CLIENT_CHANGE_USER = 512, // Support the mysql_change_user()\r
+ CLIENT_INTERACTIVE = 1024, // This is an interactive client\r
+ CLIENT_SSL = 2048, // Switch to SSL after handshake\r
+ CLIENT_IGNORE_SIGPIPE = 4096, // IGNORE sigpipes\r
+ CLIENT_TRANSACTIONS = 8192, // Client knows about transactions\r
+ CLIENT_PROTOCOL_41 = 16384,\r
+ CLIENT_SECURE_CONNECTION = 32768\r
+\r
+ }\r
+ \r
+\r
+ /// <summary>\r
+ /// DB Operations Code\r
+ /// </summary>\r
+ internal enum DBCmd : byte\r
+ {\r
+ SLEEP = 0,\r
+ QUIT = 1,\r
+ INIT_DB = 2,\r
+ QUERY = 3,\r
+ FIELD_LIST = 4,\r
+ CREATE_DB = 5,\r
+ DROP_DB = 6,\r
+ RELOAD = 7,\r
+ SHUTDOWN = 8,\r
+ STATISTICS = 9,\r
+ PROCESS_INFO = 10,\r
+ CONNECT = 11,\r
+ PROCESS_KILL = 12,\r
+ DEBUG = 13,\r
+ PING = 14,\r
+ TIME = 15,\r
+ DELAYED_INSERT = 16,\r
+ CHANGE_USER = 17,\r
+ }\r
+\r
+ /// <summary>\r
+ /// Specifies MySQL specific data type of a field, property, for use in a <see cref="MySqlParameter"/>.\r
+ /// </summary>\r
+ public enum MySqlDbType\r
+ {\r
+ /// <summary> <see cref="Decimal"/><para>A fixed precision and scale numeric value between -1038 -1 and 10 38 -1.</para></summary>\r
+ Decimal = 0, \r
+ /// <summary> <see cref="Byte"/><para>The signed range is -128 to 127. The unsigned range is 0 to 255.</para></summary>\r
+ Byte = 1, \r
+ /// <summary><see cref="Int16"/><para>A 16-bit signed or unsigned integer. The signed range is -32768 to 32767. The unsigned range is 0 to 65535</para></summary>\r
+ Short = 2,\r
+ /// <summary><see cref="Int32"/><para>A 32-bit signed or unsigned integer</para></summary>\r
+ Int = 3,\r
+ /// <summary><b>Obsolete</b> Please use Int for 32 bit values</summary>\r
+ [Obsolete("Long is no longer the correct way of specifying a 32 bit value. Use Int")]\r
+ Long = 3,\r
+ /// <summary><see cref="Single"/><para>A small (single-precision) floating-point number. Allowable values are -3.402823466E+38 to -1.175494351E-38, 0, and 1.175494351E-38 to 3.402823466E+38.</para></summary>\r
+ Float = 4,\r
+ /// <summary><see cref="Double"/><para>A normal-size (double-precision) floating-point number. Allowable values are -1.7976931348623157E+308 to -2.2250738585072014E-308, 0, and 2.2250738585072014E-308 to 1.7976931348623157E+308.</para></summary>\r
+ Double = 5,\r
+ /// <summary>Specifies a null value</summary>\r
+ Null = 6,\r
+ /// <summary>A timestamp. The range is '1970-01-01 00:00:00' to sometime in the year 2037</summary>\r
+ Timestamp = 7,\r
+ /// <summary><see cref="Int64"/><para>A 64-bit signed or unsigned integer.</para></summary>\r
+ BigInt = 8,\r
+ /// <summary><b>Obsolete</b> Please use BigInt for 64 bit values</summary>\r
+ [Obsolete("LongLong is no longer the correct way of specifying a 64 bit value. Use BigInt")]\r
+ LongLong = 8,\r
+ /// <summary>Specifies a 24 (3 byte) signed or unsigned value.</summary>\r
+ Int24 = 9,\r
+ ///<summary>Date The supported range is '1000-01-01' to '9999-12-31'.</summary>\r
+ Date = 10,\r
+ /// <summary> Time <para>The range is '-838:59:59' to '838:59:59'.</para></summary>\r
+ Time = 11,\r
+ ///<summary>DateTime The supported range is '1000-01-01 00:00:00' to '9999-12-31 23:59:59'.</summary>\r
+ Datetime = 12, \r
+ /// <summary>A year in 2- or 4-digit format (default is 4-digit). The allowable values are 1901 to 2155, 0000 in the 4-digit year format, and 1970-2069 if you use the 2-digit format (70-69)</summary>\r
+ Year = 13,\r
+ /// <summary><b>Obsolete</b> Use Datetime or Date type</summary>\r
+ Newdate = 14,\r
+ /// <summary>An enumeration. A string object that can have only one value, chosen from the list of values 'value1', 'value2', ..., NULL or the special "" error value. An ENUM can have a maximum of 65535 distinct values</summary>\r
+ Enum = 247,\r
+ /// <summary>A set. A string object that can have zero or more values, each of which must be chosen from the list of values 'value1', 'value2', ... A SET can have a maximum of 64 members.</summary>\r
+ Set = 248,\r
+ /// <summary>A BLOB or TEXT column with a maximum length of 255 (2^8 - 1) characters</summary>\r
+ TinyBlob = 249,\r
+ /// <summary>A BLOB or TEXT column with a maximum length of 16777215 (2^24 - 1) characters</summary>\r
+ MediumBlob = 250,\r
+ /// <summary>A BLOB or TEXT column with a maximum length of 4294967295 or 4G (2^32 - 1) characters</summary>\r
+ LongBlob = 251,\r
+ /// <summary>A BLOB or TEXT column with a maximum length of 65535 (2^16 - 1) characters</summary>\r
+ Blob = 252,\r
+ /// <summary>A variable-length string containing 0 to 255 characters</summary>\r
+ VarChar = 253,\r
+ /// <summary><b>Obsolete</b> Use VarChar type</summary>\r
+ String = 254\r
+ };\r
+\r
+\r
+ enum Field_Type : byte\r
+ {\r
+ DECIMAL =0,\r
+ BYTE =1,\r
+ SHORT =2,\r
+ LONG =3,\r
+ FLOAT =4,\r
+ DOUBLE =5,\r
+ NULL =6,\r
+ TIMESTAMP =7,\r
+ LONGLONG =8,\r
+ INT24 =9,\r
+ DATE =10,\r
+ TIME =11,\r
+ DATETIME =12,\r
+ YEAR =13,\r
+ NEWDATE =14,\r
+ ENUM =247,\r
+ SET =248,\r
+ TINY_BLOB =249,\r
+ MEDIUM_BLOB =250,\r
+ LONG_BLOB =251,\r
+ BLOB =252,\r
+ VAR_STRING =253,\r
+ STRING =254,\r
+ }\r
+}\r
-using System;
-using System.IO;
-using System.Text;
-
-namespace ByteFX.Data.MySqlClient
-{
-/* internal enum PacketType
- {
- None,
- UpdateOrOk,
- ResultSchema,
- Last,
- Auth,
- Error,
- LoadDataLocal,
- Other
- }*/
-
- /// <summary>
- /// Summary description for Packet.
- /// </summary>
- internal class Packet : MemoryStream
- {
- Encoding encoding;
- private static int HEADER_LEN = 7;
-
- public Packet() : base(256+HEADER_LEN)
- {
- Position = HEADER_LEN;
- }
-
- public Packet(int len) : base(len+HEADER_LEN)
- {
- Position = HEADER_LEN;
- }
-
- public Packet(byte[] bytes) : base(bytes, 0, bytes.Length, true, true)
- {
- }
-
- public Encoding Encoding
- {
- set { encoding = value; }
- get { return encoding; }
- }
-
- public byte this[int index]
- {
- get { return GetBuffer()[index]; }
- }
-
- public new int Length
- {
- get { return (int)base.Length; }
- }
-
- public bool IsLastPacket()
- {
- if (Length == 1 && this[0] == 0xfe) return true;
- return false;
- }
-
- public byte[] GetBytes( byte packetSeq )
- {
- long oldPos = Position;
- Position = 3;
- WriteInteger( Length-HEADER_LEN, 3 );
- WriteByte( packetSeq );
- Position = oldPos;
- return GetBuffer();
- }
-
- public int ReadNBytes()
- {
- byte c = (byte)ReadByte();
- if (c < 1 || c > 4) throw new MySqlException("Unexpected byte count received");
- return ReadInteger((int)c);
- }
-
- public string ReadLenString()
- {
- int len = ReadLenInteger();
-
- byte[] buffer = new Byte[len];
- Read(buffer, 0, len);
- return encoding.GetString( buffer, 0, len);
- }
-
-
- /// <summary>
- /// WriteInteger
- /// </summary>
- /// <param name="v"></param>
- /// <param name="numbytes"></param>
- public void WriteInteger( int v, int numbytes )
- {
- int val = v;
-
- if (numbytes < 1 || numbytes > 4)
- throw new ArgumentOutOfRangeException("Wrong byte count for WriteInteger");
-
- for (int x=0; x < numbytes; x++)
- {
- WriteByte( (byte)(val&0xff) );
- val >>= 8;
- }
- }
-
- /// <summary>
- ///
- /// </summary>
- /// <param name="numbytes"></param>
- /// <returns></returns>
- public int ReadInteger(int numbytes)
- {
- int val = 0;
- int raise = 1;
- for (int x=0; x < numbytes; x++)
- {
- int b = ReadByte();
- val += (b*raise);
- raise *= 256;
- }
- return val;
- }
-
- /// <summary>
- ///
- /// </summary>
- /// <returns></returns>
- public int ReadLenInteger()
- {
- byte c = (byte)ReadByte();
-
- switch(c)
- {
- case 251 : return -1;
- case 252 : return ReadInteger(2);
- case 253 : return ReadInteger(3);
- case 254 : return ReadInteger(4);
- default : return c;
- }
- }
-
- public bool HasMoreData
- {
- get { return Position < Length; }
- }
-
- #region String Functions
- public string ReadString()
- {
- System.Text.StringBuilder sb = new System.Text.StringBuilder();
-
- while ( HasMoreData )
- {
- byte b = (byte)ReadByte();
- if (b == 0) break;
- sb.Append( Convert.ToChar( b ));
- }
-
- return sb.ToString();
- }
-
- public void WriteString(string v, Encoding encoding)
- {
- WriteStringNoNull(v, encoding);
- WriteByte(0);
- }
-
- public void WriteStringNoNull(string v, Encoding encoding)
- {
- byte[] bytes = encoding.GetBytes(v);
- Write(bytes, 0, bytes.Length);
- }
-
- #endregion
-
-
- }
-}
+using System;\r
+using System.IO;\r
+using System.Text;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Summary description for Packet.\r
+ /// </summary>\r
+ internal class Packet : MemoryStream\r
+ {\r
+ Encoding encoding;\r
+ byte sequence;\r
+ int completeLen;\r
+ public static int NULL_LEN=-1;\r
+ private int shortLen = 2;\r
+ private int intLen = 3;\r
+ private int longLen = 4;\r
+ private bool longInts = false;\r
+\r
+ public Packet(bool longInts) : base()\r
+ {\r
+ LongInts = longInts;\r
+ }\r
+\r
+ public Packet(byte[] bytes, bool longInts) : base(bytes.Length)\r
+ {\r
+ this.Write( bytes, 0, bytes.Length );\r
+ Position = 0;\r
+ LongInts = longInts;\r
+ }\r
+\r
+ public bool LongInts \r
+ {\r
+ get { return longInts; }\r
+ set \r
+ { \r
+ longInts = value; \r
+ if (longInts) \r
+ {\r
+ intLen = 4;\r
+ longLen = 8;\r
+ }\r
+ }\r
+ }\r
+\r
+ public int CompleteLength \r
+ {\r
+ get { return completeLen; }\r
+ set { completeLen = value; }\r
+ }\r
+\r
+ public byte Sequence \r
+ {\r
+ get { return sequence; }\r
+ set { sequence = value; }\r
+ }\r
+\r
+ public Encoding Encoding \r
+ {\r
+ set { encoding = value; }\r
+ get { return encoding; }\r
+ }\r
+\r
+ public void Clear()\r
+ {\r
+ Position = 0;\r
+ this.SetLength(0);\r
+ }\r
+\r
+ public byte this[int index] \r
+ {\r
+ get \r
+ { \r
+ long pos = Position;\r
+ Position = index;\r
+ byte b = (byte)ReadByte();\r
+ Position = pos;\r
+ return b;\r
+ }\r
+ }\r
+\r
+ public new int Length \r
+ {\r
+ get { return (int)base.Length; }\r
+ }\r
+\r
+ public bool IsLastPacket()\r
+ {\r
+ return (Length == 1 && this[0] == 0xfe);\r
+ }\r
+\r
+ public void Append( Packet p )\r
+ {\r
+ long oldPos = Position;\r
+ Position = Length;\r
+ this.Write( p.GetBuffer(), 0, p.Length );\r
+ Position = oldPos;\r
+ }\r
+\r
+ public Packet ReadPacket()\r
+ {\r
+ if (! HasMoreData) return null;\r
+\r
+ int len = this.ReadInteger(3);\r
+ byte seq = (byte)this.ReadByte();\r
+ byte[] buf = new byte[ len ];\r
+ this.Read( buf, 0, len );\r
+ Packet p = new Packet( buf, LongInts );\r
+ p.Sequence = seq;\r
+ p.Encoding = this.Encoding;\r
+ return p;\r
+ }\r
+\r
+ public int ReadNBytes()\r
+ {\r
+ byte c = (byte)ReadByte();\r
+ if (c < 1 || c > 4) throw new MySqlException("Unexpected byte count received");\r
+ return ReadInteger((int)c);\r
+ }\r
+\r
+ public string ReadLenString()\r
+ {\r
+ long len = ReadLenInteger();\r
+\r
+ byte[] buffer = new Byte[len];\r
+ Read(buffer, 0, (int)len);\r
+ return encoding.GetString( buffer, 0, (int)len);\r
+ }\r
+\r
+\r
+ /// <summary>\r
+ /// WriteInteger\r
+ /// </summary>\r
+ /// <param name="v"></param>\r
+ /// <param name="numbytes"></param>\r
+ public void WriteInteger( int v, int numbytes )\r
+ {\r
+ int val = v;\r
+\r
+ if (numbytes < 1 || numbytes > 4) \r
+ throw new ArgumentOutOfRangeException("Wrong byte count for WriteInteger");\r
+\r
+ for (int x=0; x < numbytes; x++)\r
+ {\r
+ WriteByte( (byte)(val&0xff) );\r
+ val >>= 8;\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ /// <param name="numbytes"></param>\r
+ /// <returns></returns>\r
+ public int ReadInteger(int numbytes)\r
+ {\r
+ int val = 0;\r
+ int raise = 1;\r
+ for (int x=0; x < numbytes; x++)\r
+ {\r
+ int b = ReadByte();\r
+ val += (b*raise);\r
+ raise *= 256;\r
+ }\r
+ return val;\r
+ }\r
+\r
+ /// <summary>\r
+ /// \r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public long ReadLenInteger()\r
+ {\r
+ byte c = (byte)ReadByte();\r
+\r
+ switch(c) \r
+ {\r
+ case 251 : return NULL_LEN; \r
+ case 252 : return ReadInteger(shortLen);\r
+ case 253 : return ReadInteger(intLen);\r
+ case 254 : return ReadInteger(longLen);\r
+ default : return c;\r
+ }\r
+ }\r
+\r
+ public bool HasMoreData\r
+ {\r
+ get { return Position < Length; }\r
+ }\r
+\r
+ #region String Functions\r
+ public string ReadString()\r
+ {\r
+ System.Text.StringBuilder sb = new System.Text.StringBuilder();\r
+\r
+ while ( HasMoreData )\r
+ {\r
+ byte b = (byte)ReadByte();\r
+ if (b == 0) break;\r
+ sb.Append( Convert.ToChar( b ));\r
+ }\r
+\r
+ return sb.ToString();\r
+ }\r
+\r
+ public void WriteString(string v, Encoding encoding)\r
+ {\r
+ WriteStringNoNull(v, encoding);\r
+ WriteByte(0);\r
+ }\r
+\r
+ public void WriteStringNoNull(string v, Encoding encoding)\r
+ {\r
+ byte[] bytes = encoding.GetBytes(v);\r
+ Write(bytes, 0, bytes.Length);\r
+ }\r
+\r
+ #endregion\r
+\r
+\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Data;
-using System.ComponentModel;
-using System.Collections;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Represents a SQL statement to execute against a MySQL database. This class cannot be inherited.
- /// </summary>
- /// <include file='docs/MySqlCommand.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>
-#if WINDOWS
- [System.Drawing.ToolboxBitmap( typeof(MySqlCommand), "Designers.command.bmp")]
-#endif
- [System.ComponentModel.DesignerCategory("Code")]
- public sealed class MySqlCommand : Component, IDbCommand, ICloneable
- {
- MySqlConnection connection;
- MySqlTransaction curTransaction;
- string cmdText;
- int updateCount;
- UpdateRowSource updatedRowSource = UpdateRowSource.Both;
- MySqlParameterCollection parameters = new MySqlParameterCollection();
- private ArrayList arraySql = new ArrayList();
-
- /// <summary>
- /// Overloaded. Initializes a new instance of the MySqlCommand class.
- /// </summary>
- public MySqlCommand()
- {
- }
-
- /// <summary>
- /// Overloaded. Initializes a new instance of the MySqlCommand class.
- /// </summary>
- public MySqlCommand(string cmdText)
- {
- this.cmdText = cmdText;
- }
-
- /// <summary>
- /// Overloaded. Initializes a new instance of the MySqlCommand class.
- /// </summary>
- public MySqlCommand(System.ComponentModel.IContainer container)
- {
- // Required for Windows.Forms Class Composition Designer support
- container.Add(this);
- }
-
- /// <summary>
- /// Overloaded. Initializes a new instance of the MySqlCommand class.
- /// </summary>
- public MySqlCommand(string cmdText, MySqlConnection connection)
- {
- this.cmdText = cmdText;
- this.connection = connection;
- }
-
- /// <summary>
- /// Disposes of this instance of MySqlCommand
- /// </summary>
- public new void Dispose()
- {
- base.Dispose();
- }
-
- /// <summary>
- /// Overloaded. Initializes a new instance of the MySqlCommand class.
- /// </summary>
- public MySqlCommand(string cmdText, MySqlConnection connection, MySqlTransaction txn)
- {
- this.cmdText = cmdText;
- this.connection = connection;
- curTransaction = txn;
- }
-
- #region Properties
-
- /// <summary>
- /// Gets or sets the SQL statement to execute at the data source.
- /// </summary>
- [Category("Data")]
- [Description("Command text to execute")]
-#if WINDOWS
- [Editor(typeof(ByteFX.Data.Common.SqlCommandTextEditor), typeof(System.Drawing.Design.UITypeEditor))]
-#endif
- public string CommandText
- {
- get { return cmdText; }
- set { cmdText = value; }
- }
-
- internal int UpdateCount
- {
- get { return updateCount; }
- }
-
- /// <summary>
- /// Gets or sets the wait time before terminating the attempt to execute a command and generating an error.
- /// </summary>
- [Category("Misc")]
- [Description("Time to wait for command to execute")]
- public int CommandTimeout
- {
- // TODO: support this
- get { return 0; }
- set { if (value != 0) throw new NotSupportedException(); }
- }
-
- /// <summary>
- /// Gets or sets a value indicating how the CommandText property is to be interpreted. Only
- /// type Text is currently supported.
- /// </summary>
- [Category("Data")]
- public CommandType CommandType
- {
- get { return CommandType.Text; }
- set
- {
- if (value != CommandType.Text)
- throw new NotSupportedException("This version of the MySql provider only supports Text command types");
- }
- }
-
- /// <summary>
- /// Gets or sets the MySqlConnection used by this instance of the MySqlCommand.
- /// </summary>
- [Category("Behavior")]
- [Description("Connection used by the command")]
- public IDbConnection Connection
- {
- /*
- * The user should be able to set or change the connection at
- * any time.
- */
- get
- {
- return connection;
- }
- set
- {
- /*
- * The connection is associated with the transaction
- * so set the transaction object to return a null reference if the connection
- * is reset.
- */
- if (connection != value)
- this.Transaction = null;
-
- connection = (MySqlConnection)value;
- }
- }
-
- /// <summary>
- /// Gets the MySqlParameterCollection.
- /// </summary>
- [Category("Data")]
- [Description("The parameters collection")]
- [DesignerSerializationVisibility(DesignerSerializationVisibility.Content)]
- public MySqlParameterCollection Parameters
- {
- get { return parameters; }
- }
-
- IDataParameterCollection IDbCommand.Parameters
- {
- get { return parameters; }
- }
-
- /// <summary>
- /// Gets or sets the MySqlTransaction within which the MySqlCommand executes.
- /// </summary>
- [Browsable(false)]
- public IDbTransaction Transaction
- {
- /*
- * Set the transaction. Consider additional steps to ensure that the transaction
- * is compatible with the connection, because the two are usually linked.
- */
- get
- {
- return curTransaction;
- }
- set
- {
- curTransaction = (MySqlTransaction)value;
- }
- }
-
- /// <summary>
- /// Gets or sets how command results are applied to the DataRow when used by the Update method of the DbDataAdapter.
- /// </summary>
- [Category("Behavior")]
- public UpdateRowSource UpdatedRowSource
- {
- get
- {
- return updatedRowSource;
- }
- set
- {
- updatedRowSource = value;
- }
- }
- #endregion
-
- #region Methods
- /// <summary>
- /// Attempts to cancel the execution of a MySqlCommand. This operation is not supported.
- /// </summary>
- /// <exception cref="NotSupportedException">This operation is not supported.</exception>
- public void Cancel()
- {
- throw new NotSupportedException();
- }
-
- /// <summary>
- /// Creates a new instance of a MySqlParameter object.
- /// </summary>
- /// <returns></returns>
- public MySqlParameter CreateParameter()
- {
- return new MySqlParameter();
- }
-
- IDbDataParameter IDbCommand.CreateParameter()
- {
- return CreateParameter();
- }
-
- private ArrayList SplitSql(string sql)
- {
- ArrayList commands = new ArrayList();
- System.IO.MemoryStream ms = new System.IO.MemoryStream(sql.Length);
-
- // first we tack on a semi-colon, if not already there, to make our
- // sql processing code easier. Then we ask our encoder to give us
- // the bytes for this sql string
- byte[] bytes = connection.Encoding.GetBytes(sql + ";");
-
- byte left_byte = 0;
- bool escaped = false;
- int parm_start=-1;
- for (int x=0; x < bytes.Length; x++)
- {
- byte b = bytes[x];
-
- // if we see a quote marker, then check to see if we are opening
- // or closing a quote
- if ((b == '\'' || b == '\"') && ! escaped )
- {
- if (b == left_byte) left_byte = 0;
- else if (left_byte == 0) left_byte = b;
- }
-
- else if (b == '\\')
- {
- escaped = !escaped;
- }
-
- // if we see the marker for a parameter, then save its position and
- // look for the end
- else if (b == '@' && left_byte == 0 && ! escaped && parm_start==-1)
- parm_start = x;
-
- // if we see a space and we are tracking a parameter, then end the parameter and have
- // that parameter serialize itself to the memory stream
- else if (parm_start > -1 && (b != '@') && (b != '$') && (b != '_') && (b != '.') && ! Char.IsLetterOrDigit((char)b))
- {
- string parm_name = sql.Substring(parm_start, x-parm_start);
-
- if (parameters.Contains( parm_name ))//p != null)
- //if(parm_name.Length<2 || parm_name[1]!='@') // if doesn't begin with @@, do our processing.
- {
- MySqlParameter p = (parameters[parm_name] as MySqlParameter);
- p.SerializeToBytes(ms, connection );
- }
- else
- {
- // otherwise assume system param. just write it out
- byte[] buf = connection.Encoding.GetBytes(parm_name);
- ms.Write(buf, 0, buf.Length);
- }
- parm_start=-1;
- }
-
- // if we are not in a string and we are not escaped and we are on a semi-colon,
- // then write out what we have as a command
- if (left_byte == 0 && ! escaped && b == ';' && ms.Length > 0)
- {
- bool goodcmd = false;
- byte[] byteArray = ms.ToArray();
- foreach (byte cmdByte in byteArray)
- if (cmdByte != ' ') { goodcmd = true; break; }
-
- if (goodcmd)
- commands.Add( byteArray );
- ms.SetLength(0);
- }
- else if (parm_start == -1)
- ms.WriteByte(b);
-
-
- // we want to write out the bytes in all cases except when we are parsing out a parameter
- if (escaped && b != '\\') escaped = false;
- }
-
- return commands;
- }
-
- private void ReadOffResultSet()
- {
- Driver driver = connection.InternalConnection.Driver;
-
- // first read off the schema
- Packet packet = driver.ReadPacket();
- while (! packet.IsLastPacket())
- packet = driver.ReadPacket();
-
- // now read off the data
- packet = driver.ReadPacket();
- while (! packet.IsLastPacket())
- packet = driver.ReadPacket();
- }
-
- /// <summary>
- /// Internal function to execute the next command in an array of commands
- /// </summary>
- internal Packet ExecuteBatch( bool stopAtResultSet )
- {
- Driver driver = connection.InternalConnection.Driver;
-
- while (arraySql.Count > 0)
- {
- byte[] sql = (byte[])arraySql[0];
- arraySql.RemoveAt(0);
-
- Packet packet = driver.SendSql( sql );
- byte b = (byte)packet.ReadByte();
- if (b == 0)
- {
- if (updateCount == -1) updateCount = 0;
- updateCount += (int)packet.ReadLenInteger();
- }
- else if (stopAtResultSet)
- {
- packet.Position--;
- return packet;
- }
- else
- ReadOffResultSet();
- }
- return null;
- }
-
- /// <summary>
- /// Executes a SQL statement against the connection and returns the number of rows affected.
- /// </summary>
- /// <returns>Number of rows affected</returns>
- public int ExecuteNonQuery()
- {
- // There must be a valid and open connection.
- if (connection == null || connection.State != ConnectionState.Open)
- throw new InvalidOperationException("Connection must be valid and open");
-
- // Data readers have to be closed first
- if (connection.Reader != null)
- throw new MySqlException("There is already an open DataReader associated with this Connection which must be closed first.");
-
- // execute any commands left in the queue from before.
- //ExecuteBatch(false);
-
- arraySql = SplitSql( cmdText );
- updateCount = 0;
-
- ExecuteBatch(false);
-
- return (int)updateCount;
- }
-
- IDataReader IDbCommand.ExecuteReader ()
- {
- return ExecuteReader ();
- }
-
- IDataReader IDbCommand.ExecuteReader (CommandBehavior behavior)
- {
- return ExecuteReader (behavior);
- }
-
- /// <summary>
- /// Overloaded. Sends the CommandText to the Connection and builds a MySqlDataReader.
- /// </summary>
- /// <returns></returns>
- public MySqlDataReader ExecuteReader()
- {
- return ExecuteReader(CommandBehavior.Default);
- }
-
-
- /// <summary>
- /// Overloaded. Sends the CommandText to the Connection and builds a MySqlDataReader.
- /// </summary>
- /// <returns></returns>
- public MySqlDataReader ExecuteReader(CommandBehavior behavior)
- {
- // There must be a valid and open connection.
- if (connection == null || connection.State != ConnectionState.Open)
- throw new InvalidOperationException("Connection must be valid and open");
-
- // make sure all readers on this connection are closed
- if (connection.Reader != null)
- throw new InvalidOperationException("There is already an open DataReader associated with this Connection which must be closed first.");
-
- string sql = cmdText;
-
- if (0 != (behavior & CommandBehavior.KeyInfo))
- {
- }
-
- if (0 != (behavior & CommandBehavior.SchemaOnly))
- {
- }
-
- if (0 != (behavior & CommandBehavior.SequentialAccess))
- {
- }
-
- if (0 != (behavior & CommandBehavior.SingleResult))
- {
- }
-
- if (0 != (behavior & CommandBehavior.SingleRow))
- {
- sql = String.Format("SET SQL_SELECT_LIMIT=1;{0};SET sql_select_limit=-1;", cmdText);
- }
-
- arraySql = SplitSql( sql );
-
- updateCount = -1;
- MySqlDataReader reader = new MySqlDataReader(this, behavior);
-
- // move to the first resultset
- reader.NextResult();
- connection.Reader = reader;
- return reader;
- }
-
- /// <summary>
- /// Executes the query, and returns the first column of the first row in the
- /// result set returned by the query. Extra columns or rows are ignored.
- /// </summary>
- /// <returns></returns>
- public object ExecuteScalar()
- {
- // There must be a valid and open connection.
- if (connection == null || connection.State != ConnectionState.Open)
- throw new InvalidOperationException("Connection must be valid and open");
-
- // Data readers have to be closed first
- if (connection.Reader != null)
- throw new MySqlException("There is already an open DataReader associated with this Connection which must be closed first.");
-
- arraySql = SplitSql( cmdText );
-
- updateCount = -1;
- MySqlDataReader reader = new MySqlDataReader(this, 0);
- reader.NextResult();
- object val = null;
- if (reader.Read())
- val = reader.GetValue(0);
- reader.Close();
- return val;
- }
-
- /// <summary>
- /// Creates a prepared version of the command on an instance of MySQL Server. This
- /// is currently not supported.
- /// </summary>
- public void Prepare()
- {
- }
- #endregion
-
- #region ICloneable
- /// <summary>
- /// Creates a clone of this MySqlCommand object. CommandText, Connection, and Transaction properties
- /// are included as well as the entire parameter list.
- /// </summary>
- /// <returns>The cloned MySqlCommand object</returns>
- public object Clone()
- {
- MySqlCommand clone = new MySqlCommand(cmdText, connection, curTransaction);
- foreach (MySqlParameter p in parameters)
- {
- clone.Parameters.Add((p as ICloneable).Clone());
- }
- return clone;
- }
- #endregion
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Data;\r
+using System.ComponentModel;\r
+using System.Collections;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Represents a SQL statement to execute against a MySQL database. This class cannot be inherited.\r
+ /// </summary>\r
+ /// <include file='docs/MySqlCommand.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>\r
+#if WINDOWS\r
+ [System.Drawing.ToolboxBitmap( typeof(MySqlCommand), "MySqlClient.resources.command.bmp")]\r
+#endif\r
+ [System.ComponentModel.DesignerCategory("Code")]\r
+ public sealed class MySqlCommand : Component, IDbCommand, ICloneable\r
+ {\r
+ MySqlConnection connection;\r
+ MySqlTransaction curTransaction;\r
+ string cmdText;\r
+ int updateCount;\r
+ UpdateRowSource updatedRowSource = UpdateRowSource.Both;\r
+ MySqlParameterCollection parameters = new MySqlParameterCollection();\r
+ private ArrayList arraySql = new ArrayList();\r
+\r
+ /// <summary>\r
+ /// Overloaded. Initializes a new instance of the MySqlCommand class.\r
+ /// </summary>\r
+ public MySqlCommand()\r
+ {\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overloaded. Initializes a new instance of the MySqlCommand class.\r
+ /// </summary>\r
+ public MySqlCommand(string cmdText)\r
+ {\r
+ this.cmdText = cmdText;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overloaded. Initializes a new instance of the MySqlCommand class.\r
+ /// </summary>\r
+ public MySqlCommand(System.ComponentModel.IContainer container)\r
+ {\r
+ // Required for Windows.Forms Class Composition Designer support\r
+ container.Add(this);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overloaded. Initializes a new instance of the MySqlCommand class.\r
+ /// </summary>\r
+ public MySqlCommand(string cmdText, MySqlConnection connection)\r
+ {\r
+ this.cmdText = cmdText;\r
+ this.connection = connection;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Disposes of this instance of MySqlCommand\r
+ /// </summary>\r
+ public new void Dispose() \r
+ {\r
+ base.Dispose();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overloaded. Initializes a new instance of the MySqlCommand class.\r
+ /// </summary>\r
+ public MySqlCommand(string cmdText, MySqlConnection connection, MySqlTransaction txn)\r
+ {\r
+ this.cmdText = cmdText;\r
+ this.connection = connection;\r
+ curTransaction = txn;\r
+ } \r
+\r
+ #region Properties\r
+\r
+ /// <summary>\r
+ /// Gets or sets the SQL statement to execute at the data source.\r
+ /// </summary>\r
+ [Category("Data")]\r
+ [Description("Command text to execute")]\r
+#if WINDOWS\r
+ [Editor("ByteFX.Data.Common.Design.SqlCommandTextEditor,MySqlClient.Design", typeof(System.Drawing.Design.UITypeEditor))]\r
+#endif\r
+ public string CommandText\r
+ {\r
+ get { return cmdText; }\r
+ set { cmdText = value; }\r
+ }\r
+\r
+ internal int UpdateCount \r
+ {\r
+ get { return updateCount; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the wait time before terminating the attempt to execute a command and generating an error.\r
+ /// </summary>\r
+ [Category("Misc")]\r
+ [Description("Time to wait for command to execute")]\r
+ public int CommandTimeout\r
+ {\r
+ // TODO: support this\r
+ get { return 0; }\r
+ set { if (value != 0) throw new NotSupportedException(); }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets a value indicating how the CommandText property is to be interpreted. Only\r
+ /// type Text is currently supported.\r
+ /// </summary>\r
+ [Category("Data")]\r
+ public CommandType CommandType\r
+ {\r
+ get { return CommandType.Text; }\r
+ set \r
+ { \r
+ if (value != CommandType.Text) \r
+ throw new NotSupportedException("This version of the MySql provider only supports Text command types"); \r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the MySqlConnection used by this instance of the MySqlCommand.\r
+ /// </summary>\r
+ [Category("Behavior")]\r
+ [Description("Connection used by the command")]\r
+ public IDbConnection Connection\r
+ {\r
+ /*\r
+ * The user should be able to set or change the connection at \r
+ * any time.\r
+ */\r
+ get \r
+ { \r
+ return connection; \r
+ }\r
+ set\r
+ {\r
+ /*\r
+ * The connection is associated with the transaction\r
+ * so set the transaction object to return a null reference if the connection \r
+ * is reset.\r
+ */\r
+ if (connection != value)\r
+ this.Transaction = null;\r
+\r
+ connection = (MySqlConnection)value;\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the MySqlParameterCollection.\r
+ /// </summary>\r
+ [Category("Data")]\r
+ [Description("The parameters collection")]\r
+ [DesignerSerializationVisibility(DesignerSerializationVisibility.Content)]\r
+ public MySqlParameterCollection Parameters\r
+ {\r
+ get { return parameters; }\r
+ }\r
+\r
+ IDataParameterCollection IDbCommand.Parameters\r
+ {\r
+ get { return parameters; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the MySqlTransaction within which the MySqlCommand executes.\r
+ /// </summary>\r
+ [Browsable(false)]\r
+ public IDbTransaction Transaction\r
+ {\r
+ /*\r
+ * Set the transaction. Consider additional steps to ensure that the transaction\r
+ * is compatible with the connection, because the two are usually linked.\r
+ */\r
+ get \r
+ { \r
+ return curTransaction; \r
+ }\r
+ set \r
+ { \r
+ curTransaction = (MySqlTransaction)value; \r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets how command results are applied to the DataRow when used by the Update method of the DbDataAdapter.\r
+ /// </summary>\r
+ [Category("Behavior")]\r
+ public UpdateRowSource UpdatedRowSource\r
+ {\r
+ get \r
+ { \r
+ return updatedRowSource; \r
+ }\r
+ set \r
+ { \r
+ updatedRowSource = value; \r
+ }\r
+ }\r
+ #endregion\r
+\r
+ #region Methods\r
+ /// <summary>\r
+ /// Attempts to cancel the execution of a MySqlCommand. This operation is not supported.\r
+ /// </summary>\r
+ /// <exception cref="NotSupportedException">This operation is not supported.</exception>\r
+ public void Cancel()\r
+ {\r
+ throw new NotSupportedException();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Creates a new instance of a MySqlParameter object.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public MySqlParameter CreateParameter()\r
+ {\r
+ return new MySqlParameter();\r
+ }\r
+\r
+ IDbDataParameter IDbCommand.CreateParameter()\r
+ {\r
+ return CreateParameter();\r
+ }\r
+\r
+ private ArrayList SplitSql(string sql)\r
+ {\r
+ ArrayList commands = new ArrayList();\r
+ System.IO.MemoryStream ms = new System.IO.MemoryStream(sql.Length);\r
+\r
+ // first we tack on a semi-colon, if not already there, to make our\r
+ // sql processing code easier. Then we ask our encoder to give us\r
+ // the bytes for this sql string\r
+ byte[] bytes = connection.Encoding.GetBytes(sql + ";");\r
+\r
+ byte left_byte = 0;\r
+ bool escaped = false;\r
+ int parm_start=-1;\r
+ for (int x=0; x < bytes.Length; x++)\r
+ {\r
+ byte b = bytes[x];\r
+\r
+ // if we see a quote marker, then check to see if we are opening\r
+ // or closing a quote\r
+ if ((b == '\'' || b == '\"') && ! escaped )\r
+ {\r
+ if (b == left_byte) left_byte = 0;\r
+ else if (left_byte == 0) left_byte = b;\r
+ }\r
+\r
+ else if (b == '\\') \r
+ {\r
+ escaped = !escaped;\r
+ }\r
+\r
+ // if we see the marker for a parameter, then save its position and\r
+ // look for the end\r
+ else if (b == '@' && left_byte == 0 && ! escaped && parm_start==-1) \r
+ parm_start = x;\r
+\r
+ // if we see a space and we are tracking a parameter, then end the parameter and have\r
+ // that parameter serialize itself to the memory stream\r
+ else if (parm_start > -1 && (b != '@') && (b != '$') && (b != '_') && (b != '.') && ! Char.IsLetterOrDigit((char)b))\r
+ {\r
+ string parm_name = sql.Substring(parm_start, x-parm_start); \r
+\r
+ if (parameters.Contains( parm_name ))\r
+ {\r
+ MySqlParameter p = (parameters[parm_name] as MySqlParameter);\r
+ p.SerializeToBytes(ms, connection );\r
+ }\r
+ else\r
+ {\r
+ // otherwise assume system param. just write it out\r
+ byte[] buf = connection.Encoding.GetBytes(parm_name);\r
+ ms.Write(buf, 0, buf.Length); \r
+ }\r
+ parm_start=-1;\r
+ }\r
+\r
+ // if we are not in a string and we are not escaped and we are on a semi-colon,\r
+ // then write out what we have as a command\r
+ if (left_byte == 0 && ! escaped && b == ';' && ms.Length > 0)\r
+ {\r
+ bool goodcmd = false;\r
+ byte[] byteArray = ms.ToArray();\r
+ foreach (byte cmdByte in byteArray)\r
+ if (cmdByte != ' ') { goodcmd = true; break; }\r
+\r
+ if (goodcmd)\r
+ commands.Add( byteArray );\r
+ ms.SetLength(0);\r
+ }\r
+ else if (parm_start == -1)\r
+ ms.WriteByte(b);\r
+\r
+\r
+ // we want to write out the bytes in all cases except when we are parsing out a parameter\r
+ if (escaped && b != '\\') escaped = false;\r
+ }\r
+\r
+ return commands;\r
+ }\r
+\r
+ private void ReadOffResultSet()\r
+ {\r
+ Driver driver = connection.InternalConnection.Driver;\r
+\r
+ // first read off the schema\r
+ Packet packet = driver.ReadPacket();\r
+ while (! packet.IsLastPacket())\r
+ packet = driver.ReadPacket();\r
+\r
+ // now read off the data\r
+ packet = driver.ReadPacket();\r
+ while (! packet.IsLastPacket())\r
+ packet = driver.ReadPacket();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Internal function to execute the next command in an array of commands\r
+ /// </summary>\r
+ internal CommandResult ExecuteBatch( bool stopAtResultSet )\r
+ {\r
+ Driver driver = connection.InternalConnection.Driver;\r
+\r
+ while (arraySql.Count > 0)\r
+ {\r
+ byte[] sql = (byte[])arraySql[0];\r
+ arraySql.RemoveAt(0);\r
+\r
+ CommandResult result = driver.Send( DBCmd.QUERY, sql );\r
+ \r
+ if (result.IsResultSet)\r
+ {\r
+ if (stopAtResultSet) return result;\r
+ result.Clear();\r
+ continue;\r
+ }\r
+\r
+ // at this point, we know it is a zero field count\r
+ if (updateCount == -1) updateCount = 0;\r
+ updateCount += result.RowsAffected;\r
+ }\r
+ return null;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Executes a SQL statement against the connection and returns the number of rows affected.\r
+ /// </summary>\r
+ /// <returns>Number of rows affected</returns>\r
+ public int ExecuteNonQuery()\r
+ {\r
+ // There must be a valid and open connection.\r
+ if (connection == null || connection.State != ConnectionState.Open)\r
+ throw new InvalidOperationException("Connection must be valid and open");\r
+\r
+ // Data readers have to be closed first\r
+ if (connection.Reader != null)\r
+ throw new MySqlException("There is already an open DataReader associated with this Connection which must be closed first.");\r
+\r
+ // execute any commands left in the queue from before.\r
+ //ExecuteBatch(false);\r
+ \r
+ arraySql = SplitSql( cmdText );\r
+ updateCount = 0;\r
+\r
+ ExecuteBatch(false);\r
+\r
+ return (int)updateCount;\r
+ }\r
+\r
+ IDataReader IDbCommand.ExecuteReader ()\r
+ {\r
+ return ExecuteReader ();\r
+ }\r
+\r
+ IDataReader IDbCommand.ExecuteReader (CommandBehavior behavior)\r
+ {\r
+ return ExecuteReader (behavior);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overloaded. Sends the CommandText to the Connection and builds a MySqlDataReader.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public MySqlDataReader ExecuteReader()\r
+ {\r
+ return ExecuteReader(CommandBehavior.Default);\r
+ }\r
+\r
+\r
+ /// <summary>\r
+ /// Overloaded. Sends the CommandText to the Connection and builds a MySqlDataReader.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public MySqlDataReader ExecuteReader(CommandBehavior behavior)\r
+ {\r
+ // There must be a valid and open connection.\r
+ if (connection == null || connection.State != ConnectionState.Open)\r
+ throw new InvalidOperationException("Connection must be valid and open");\r
+\r
+ // make sure all readers on this connection are closed\r
+ if (connection.Reader != null)\r
+ throw new InvalidOperationException("There is already an open DataReader associated with this Connection which must be closed first.");\r
+\r
+ string sql = cmdText;\r
+\r
+ if (0 != (behavior & CommandBehavior.KeyInfo))\r
+ {\r
+ }\r
+\r
+ if (0 != (behavior & CommandBehavior.SchemaOnly))\r
+ {\r
+ }\r
+\r
+ if (0 != (behavior & CommandBehavior.SequentialAccess))\r
+ {\r
+ }\r
+\r
+ if (0 != (behavior & CommandBehavior.SingleResult))\r
+ {\r
+ }\r
+\r
+ if (0 != (behavior & CommandBehavior.SingleRow))\r
+ {\r
+ sql = String.Format("SET SQL_SELECT_LIMIT=1;{0};SET sql_select_limit=-1;", cmdText);\r
+ }\r
+\r
+ arraySql = SplitSql( sql );\r
+\r
+ updateCount = -1;\r
+ MySqlDataReader reader = new MySqlDataReader(this, behavior);\r
+\r
+ // move to the first resultset\r
+ reader.NextResult();\r
+ connection.Reader = reader;\r
+ return reader;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Executes the query, and returns the first column of the first row in the \r
+ /// result set returned by the query. Extra columns or rows are ignored.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public object ExecuteScalar()\r
+ {\r
+ // There must be a valid and open connection.\r
+ if (connection == null || connection.State != ConnectionState.Open)\r
+ throw new InvalidOperationException("Connection must be valid and open");\r
+\r
+ // Data readers have to be closed first\r
+ if (connection.Reader != null)\r
+ throw new MySqlException("There is already an open DataReader associated with this Connection which must be closed first.");\r
+\r
+ arraySql = SplitSql( cmdText );\r
+\r
+ updateCount = -1;\r
+ MySqlDataReader reader = new MySqlDataReader(this, 0);\r
+ reader.NextResult();\r
+ object val = null;\r
+ if (reader.Read())\r
+ val = reader.GetValue(0);\r
+ reader.Close();\r
+ return val;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Creates a prepared version of the command on an instance of MySQL Server. This\r
+ /// is currently not supported.\r
+ /// </summary>\r
+ public void Prepare()\r
+ {\r
+ }\r
+ #endregion\r
+\r
+ #region ICloneable\r
+ /// <summary>\r
+ /// Creates a clone of this MySqlCommand object. CommandText, Connection, and Transaction properties\r
+ /// are included as well as the entire parameter list.\r
+ /// </summary>\r
+ /// <returns>The cloned MySqlCommand object</returns>\r
+ public object Clone() \r
+ {\r
+ MySqlCommand clone = new MySqlCommand(cmdText, connection, curTransaction);\r
+ foreach (MySqlParameter p in parameters) \r
+ {\r
+ clone.Parameters.Add((p as ICloneable).Clone());\r
+ }\r
+ return clone;\r
+ }\r
+ #endregion\r
+ }\r
+}\r
-<?xml version="1.0" encoding="utf-8" ?>
-<root>
- <xsd:schema id="root" xmlns="" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:msdata="urn:schemas-microsoft-com:xml-msdata">
- <xsd:element name="root" msdata:IsDataSet="true">
- <xsd:complexType>
- <xsd:choice maxOccurs="unbounded">
- <xsd:element name="data">
- <xsd:complexType>
- <xsd:sequence>
- <xsd:element name="value" type="xsd:string" minOccurs="0" msdata:Ordinal="1" />
- <xsd:element name="comment" type="xsd:string" minOccurs="0" msdata:Ordinal="2" />
- </xsd:sequence>
- <xsd:attribute name="name" type="xsd:string" />
- <xsd:attribute name="type" type="xsd:string" />
- <xsd:attribute name="mimetype" type="xsd:string" />
- </xsd:complexType>
- </xsd:element>
- <xsd:element name="resheader">
- <xsd:complexType>
- <xsd:sequence>
- <xsd:element name="value" type="xsd:string" minOccurs="0" msdata:Ordinal="1" />
- </xsd:sequence>
- <xsd:attribute name="name" type="xsd:string" use="required" />
- </xsd:complexType>
- </xsd:element>
- </xsd:choice>
- </xsd:complexType>
- </xsd:element>
- </xsd:schema>
- <resheader name="ResMimeType">
- <value>text/microsoft-resx</value>
- </resheader>
- <resheader name="Version">
- <value>1.0.0.0</value>
- </resheader>
- <resheader name="Reader">
- <value>System.Resources.ResXResourceReader, System.Windows.Forms, Version=1.0.3102.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>
- </resheader>
- <resheader name="Writer">
- <value>System.Resources.ResXResourceWriter, System.Windows.Forms, Version=1.0.3102.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>
- </resheader>
-</root>
+<?xml version="1.0" encoding="utf-8" ?>\r
+<root>\r
+ <xsd:schema id="root" xmlns="" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:msdata="urn:schemas-microsoft-com:xml-msdata">\r
+ <xsd:element name="root" msdata:IsDataSet="true">\r
+ <xsd:complexType>\r
+ <xsd:choice maxOccurs="unbounded">\r
+ <xsd:element name="data">\r
+ <xsd:complexType>\r
+ <xsd:sequence>\r
+ <xsd:element name="value" type="xsd:string" minOccurs="0" msdata:Ordinal="1" />\r
+ <xsd:element name="comment" type="xsd:string" minOccurs="0" msdata:Ordinal="2" />\r
+ </xsd:sequence>\r
+ <xsd:attribute name="name" type="xsd:string" />\r
+ <xsd:attribute name="type" type="xsd:string" />\r
+ <xsd:attribute name="mimetype" type="xsd:string" />\r
+ </xsd:complexType>\r
+ </xsd:element>\r
+ <xsd:element name="resheader">\r
+ <xsd:complexType>\r
+ <xsd:sequence>\r
+ <xsd:element name="value" type="xsd:string" minOccurs="0" msdata:Ordinal="1" />\r
+ </xsd:sequence>\r
+ <xsd:attribute name="name" type="xsd:string" use="required" />\r
+ </xsd:complexType>\r
+ </xsd:element>\r
+ </xsd:choice>\r
+ </xsd:complexType>\r
+ </xsd:element>\r
+ </xsd:schema>\r
+ <resheader name="ResMimeType">\r
+ <value>text/microsoft-resx</value>\r
+ </resheader>\r
+ <resheader name="Version">\r
+ <value>1.0.0.0</value>\r
+ </resheader>\r
+ <resheader name="Reader">\r
+ <value>System.Resources.ResXResourceReader, System.Windows.Forms, Version=1.0.3102.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>\r
+ </resheader>\r
+ <resheader name="Writer">\r
+ <value>System.Resources.ResXResourceWriter, System.Windows.Forms, Version=1.0.3102.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>\r
+ </resheader>\r
+</root>\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System.Data;
-using System.Data.Common;
-using System.ComponentModel;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Represents a set of data commands and a database connection that are used to fill a dataset and update a MySQL database. This class cannot be inherited.
- /// </summary>
- /// <include file='docs/MySqlDataAdapter.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>
- [System.Drawing.ToolboxBitmap( typeof(MySqlDataAdapter), "Designers.dataadapter.bmp")]
- [System.ComponentModel.DesignerCategory("Code")]
- public sealed class MySqlDataAdapter : DbDataAdapter, IDbDataAdapter
- {
- private MySqlCommand m_selectCommand;
- private MySqlCommand m_insertCommand;
- private MySqlCommand m_updateCommand;
- private MySqlCommand m_deleteCommand;
-
- /*
- * Inherit from Component through DbDataAdapter. The event
- * mechanism is designed to work with the Component.Events
- * property. These variables are the keys used to find the
- * events in the components list of events.
- */
- static private readonly object EventRowUpdated = new object();
- static private readonly object EventRowUpdating = new object();
-
-
- /// <summary>
- /// Initializes a new instance of the MySqlDataAdapter class.
- /// </summary>
- public MySqlDataAdapter()
- {
- }
-
- /// <summary>
- /// Initializes a new instance of the MySqlDataAdapter class with the specified MySqlCommand as the SelectCommand property.
- /// </summary>
- /// <param name="selectCommand"></param>
- public MySqlDataAdapter( MySqlCommand selectCommand )
- {
- SelectCommand = selectCommand;
- }
-
- /// <summary>
- /// Initializes a new instance of the MySqlDataAdapter class with a SelectCommand and a MySqlConnection object.
- /// </summary>
- /// <param name="selectCommandText"></param>
- /// <param name="conn"></param>
- public MySqlDataAdapter( string selectCommandText, MySqlConnection conn)
- {
- SelectCommand = new MySqlCommand( selectCommandText, conn );
- }
-
- /// <summary>
- /// Initializes a new instance of the MySqlDataAdapter class with a SelectCommand and a connection string.
- /// </summary>
- /// <param name="selectCommandText"></param>
- /// <param name="selectConnString"></param>
- public MySqlDataAdapter( string selectCommandText, string selectConnString)
- {
- SelectCommand = new MySqlCommand( selectCommandText,
- new MySqlConnection(selectConnString) );
- }
-
- #region Properties
- /// <summary>
- /// Gets or sets a SQL statement to delete records from the data set.
- /// </summary>
- [DataSysDescription("Used during Update for deleted rows in Dataset.")]
- public MySqlCommand DeleteCommand
- {
- get { return m_deleteCommand; }
- set { m_deleteCommand = value; }
- }
-
- IDbCommand IDbDataAdapter.DeleteCommand
- {
- get { return m_deleteCommand; }
- set { m_deleteCommand = (MySqlCommand)value; }
- }
-
- /// <summary>
- /// Gets or sets a SQL statement to insert new records into the data source.
- /// </summary>
- [DataSysDescription("Used during Update for new rows in Dataset.")]
- public MySqlCommand InsertCommand
- {
- get { return m_insertCommand; }
- set { m_insertCommand = value; }
- }
-
- IDbCommand IDbDataAdapter.InsertCommand
- {
- get { return m_insertCommand; }
- set { m_insertCommand = (MySqlCommand)value; }
- }
-
- /// <summary>
- /// Gets or sets a SQL statement used to select records in the data source.
- /// </summary>
- [DataSysDescription("Used during Fill/FillSchema")]
- [Category("Fill")]
- public MySqlCommand SelectCommand
- {
- get { return m_selectCommand; }
- set { m_selectCommand = value; }
- }
-
- IDbCommand IDbDataAdapter.SelectCommand
- {
- get { return m_selectCommand; }
- set { m_selectCommand = (MySqlCommand)value; }
- }
-
- /// <summary>
- /// Gets or sets a SQL statement used to update records in the data source.
- /// </summary>
- [DataSysDescription("Used during Update for modified rows in Dataset.")]
- public MySqlCommand UpdateCommand
- {
- get { return m_updateCommand; }
- set { m_updateCommand = value; }
- }
-
- IDbCommand IDbDataAdapter.UpdateCommand
- {
- get { return m_updateCommand; }
- set { m_updateCommand = (MySqlCommand)value; }
- }
-
- #endregion
-
- /*
- * Implement abstract methods inherited from DbDataAdapter.
- */
- /// <summary>
- /// Overridden. See <see cref="DbDataAdapter.CreateRowUpdatedEvent"/>.
- /// </summary>
- /// <param name="dataRow"></param>
- /// <param name="command"></param>
- /// <param name="statementType"></param>
- /// <param name="tableMapping"></param>
- /// <returns></returns>
- override protected RowUpdatedEventArgs CreateRowUpdatedEvent(DataRow dataRow, IDbCommand command, StatementType statementType, DataTableMapping tableMapping)
- {
- return new MySqlRowUpdatedEventArgs(dataRow, command, statementType, tableMapping);
- }
-
- /// <summary>
- /// Overridden. See <see cref="DbDataAdapter.CreateRowUpdatingEvent"/>.
- /// </summary>
- /// <param name="dataRow"></param>
- /// <param name="command"></param>
- /// <param name="statementType"></param>
- /// <param name="tableMapping"></param>
- /// <returns></returns>
- override protected RowUpdatingEventArgs CreateRowUpdatingEvent(DataRow dataRow, IDbCommand command, StatementType statementType, DataTableMapping tableMapping)
- {
- return new MySqlRowUpdatingEventArgs(dataRow, command, statementType, tableMapping);
- }
-
- /// <summary>
- /// Overridden. Raises the RowUpdating event.
- /// </summary>
- /// <param name="value">A MySqlRowUpdatingEventArgs that contains the event data.</param>
- override protected void OnRowUpdating(RowUpdatingEventArgs value)
- {
- MySqlRowUpdatingEventHandler handler = (MySqlRowUpdatingEventHandler) Events[EventRowUpdating];
- if ((null != handler) && (value is MySqlRowUpdatingEventArgs))
- {
- handler(this, (MySqlRowUpdatingEventArgs) value);
- }
- }
-
- /// <summary>
- /// Overridden. Raises the RowUpdated event.
- /// </summary>
- /// <param name="value">A MySqlRowUpdatedEventArgs that contains the event data. </param>
- override protected void OnRowUpdated(RowUpdatedEventArgs value)
- {
- MySqlRowUpdatedEventHandler handler = (MySqlRowUpdatedEventHandler) Events[EventRowUpdated];
- if ((null != handler) && (value is MySqlRowUpdatedEventArgs))
- {
- handler(this, (MySqlRowUpdatedEventArgs) value);
- }
- }
-
- /// <summary>
- /// Occurs during Update before a command is executed against the data source. The attempt to update is made, so the event fires.
- /// </summary>
- public event MySqlRowUpdatingEventHandler RowUpdating
- {
- add { Events.AddHandler(EventRowUpdating, value); }
- remove { Events.RemoveHandler(EventRowUpdating, value); }
- }
-
- /// <summary>
- /// Occurs during Update after a command is executed against the data source. The attempt to update is made, so the event fires.
- /// </summary>
- public event MySqlRowUpdatedEventHandler RowUpdated
- {
- add { Events.AddHandler(EventRowUpdated, value); }
- remove { Events.RemoveHandler(EventRowUpdated, value); }
- }
- }
-
- /// <summary>
- /// Represents the method that will handle the <see cref="MySqlDataAdapter.RowUpdating"/> event of a <see cref="MySqlDataAdapter"/>.
- /// </summary>
- public delegate void MySqlRowUpdatingEventHandler(object sender, MySqlRowUpdatingEventArgs e);
-
- /// <summary>
- /// Represents the method that will handle the <see cref="MySqlDataAdapter.RowUpdated"/> event of a <see cref="MySqlDataAdapter"/>.
- /// </summary>
- public delegate void MySqlRowUpdatedEventHandler(object sender, MySqlRowUpdatedEventArgs e);
-
- /// <summary>
- /// Provides data for the RowUpdating event. This class cannot be inherited.
- /// </summary>
- public sealed class MySqlRowUpdatingEventArgs : RowUpdatingEventArgs
- {
- /// <summary>
- /// Initializes a new instance of the MySqlRowUpdatingEventArgs class.
- /// </summary>
- /// <param name="row">The <see cref="DataRow"/> to <see cref="DbDataAdapter.Update"/>.</param>
- /// <param name="command">The <see cref="IDbCommand"/> to execute during <see cref="DbDataAdapter.Update"/>.</param>
- /// <param name="statementType">One of the <see cref="StatementType"/> values that specifies the type of query executed.</param>
- /// <param name="tableMapping">The <see cref="DataTableMapping"/> sent through an <see cref="DbDataAdapter.Update"/>.</param>
- public MySqlRowUpdatingEventArgs(DataRow row, IDbCommand command, StatementType statementType, DataTableMapping tableMapping)
- : base(row, command, statementType, tableMapping)
- {
- }
-
- /// <summary>
- /// Gets or sets the MySqlCommand to execute when performing the Update.
- /// </summary>
- new public MySqlCommand Command
- {
- get { return (MySqlCommand)base.Command; }
- set { base.Command = value; }
- }
- }
-
- /// <summary>
- /// Provides data for the RowUpdated event. This class cannot be inherited.
- /// </summary>
- public sealed class MySqlRowUpdatedEventArgs : RowUpdatedEventArgs
- {
- /// <summary>
- /// Initializes a new instance of the MySqlRowUpdatedEventArgs class.
- /// </summary>
- /// <param name="row">The <see cref="DataRow"/> sent through an <see cref="DbDataAdapter.Update"/>.</param>
- /// <param name="command">The <see cref="IDbCommand"/> executed when <see cref="DbDataAdapter.Update"/> is called.</param>
- /// <param name="statementType">One of the <see cref="StatementType"/> values that specifies the type of query executed.</param>
- /// <param name="tableMapping">The <see cref="DataTableMapping"/> sent through an <see cref="DbDataAdapter.Update"/>.</param>
- public MySqlRowUpdatedEventArgs(DataRow row, IDbCommand command, StatementType statementType, DataTableMapping tableMapping)
- : base(row, command, statementType, tableMapping)
- {
- }
-
- /// <summary>
- /// Gets or sets the MySqlCommand executed when Update is called.
- /// </summary>
- new public MySqlCommand Command
- {
- get { return (MySqlCommand)base.Command; }
- }
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System.Data;\r
+using System.Data.Common;\r
+using System.ComponentModel;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Represents a set of data commands and a database connection that are used to fill a dataset and update a MySQL database. This class cannot be inherited.\r
+ /// </summary>\r
+ /// <include file='docs/MySqlDataAdapter.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>\r
+ [System.Drawing.ToolboxBitmap( typeof(MySqlDataAdapter), "MySqlClient.resources.dataadapter.bmp")]\r
+ [System.ComponentModel.DesignerCategory("Code")]\r
+ [Designer("ByteFX.Data.MySqlClient.Design.MySqlDataAdapterDesigner,MySqlClient.Design")]\r
+ public sealed class MySqlDataAdapter : DbDataAdapter, IDbDataAdapter\r
+ {\r
+ private MySqlCommand m_selectCommand;\r
+ private MySqlCommand m_insertCommand;\r
+ private MySqlCommand m_updateCommand;\r
+ private MySqlCommand m_deleteCommand;\r
+\r
+ /*\r
+ * Inherit from Component through DbDataAdapter. The event\r
+ * mechanism is designed to work with the Component.Events\r
+ * property. These variables are the keys used to find the\r
+ * events in the components list of events.\r
+ */\r
+ static private readonly object EventRowUpdated = new object(); \r
+ static private readonly object EventRowUpdating = new object(); \r
+\r
+\r
+ /// <summary>\r
+ /// Initializes a new instance of the MySqlDataAdapter class.\r
+ /// </summary>\r
+ public MySqlDataAdapter()\r
+ {\r
+ }\r
+\r
+ /// <summary>\r
+ /// Initializes a new instance of the MySqlDataAdapter class with the specified MySqlCommand as the SelectCommand property.\r
+ /// </summary>\r
+ /// <param name="selectCommand"></param>\r
+ public MySqlDataAdapter( MySqlCommand selectCommand ) \r
+ {\r
+ SelectCommand = selectCommand;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Initializes a new instance of the MySqlDataAdapter class with a SelectCommand and a MySqlConnection object.\r
+ /// </summary>\r
+ /// <param name="selectCommandText"></param>\r
+ /// <param name="conn"></param>\r
+ public MySqlDataAdapter( string selectCommandText, MySqlConnection conn) \r
+ {\r
+ SelectCommand = new MySqlCommand( selectCommandText, conn );\r
+ }\r
+\r
+ /// <summary>\r
+ /// Initializes a new instance of the MySqlDataAdapter class with a SelectCommand and a connection string.\r
+ /// </summary>\r
+ /// <param name="selectCommandText"></param>\r
+ /// <param name="selectConnString"></param>\r
+ public MySqlDataAdapter( string selectCommandText, string selectConnString) \r
+ {\r
+ SelectCommand = new MySqlCommand( selectCommandText, \r
+ new MySqlConnection(selectConnString) );\r
+ }\r
+\r
+ #region Properties\r
+ /// <summary>\r
+ /// Gets or sets a SQL statement to delete records from the data set.\r
+ /// </summary>\r
+ [Description("Used during Update for deleted rows in Dataset.")]\r
+ public MySqlCommand DeleteCommand \r
+ {\r
+ get { return m_deleteCommand; }\r
+ set { m_deleteCommand = value; }\r
+ }\r
+\r
+ IDbCommand IDbDataAdapter.DeleteCommand \r
+ {\r
+ get { return m_deleteCommand; }\r
+ set { m_deleteCommand = (MySqlCommand)value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets a SQL statement to insert new records into the data source.\r
+ /// </summary>\r
+ [Description("Used during Update for new rows in Dataset.")]\r
+ public MySqlCommand InsertCommand \r
+ {\r
+ get { return m_insertCommand; }\r
+ set { m_insertCommand = value; }\r
+ }\r
+\r
+ IDbCommand IDbDataAdapter.InsertCommand \r
+ {\r
+ get { return m_insertCommand; }\r
+ set { m_insertCommand = (MySqlCommand)value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets a SQL statement used to select records in the data source.\r
+ /// </summary>\r
+ [Description("Used during Fill/FillSchema")]\r
+ [Category("Fill")]\r
+ public MySqlCommand SelectCommand \r
+ {\r
+ get { return m_selectCommand; }\r
+ set { m_selectCommand = value; }\r
+ }\r
+\r
+ IDbCommand IDbDataAdapter.SelectCommand \r
+ {\r
+ get { return m_selectCommand; }\r
+ set { m_selectCommand = (MySqlCommand)value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets a SQL statement used to update records in the data source.\r
+ /// </summary>\r
+ [Description("Used during Update for modified rows in Dataset.")]\r
+ public MySqlCommand UpdateCommand \r
+ {\r
+ get { return m_updateCommand; }\r
+ set { m_updateCommand = value; }\r
+ }\r
+\r
+ IDbCommand IDbDataAdapter.UpdateCommand \r
+ {\r
+ get { return m_updateCommand; }\r
+ set { m_updateCommand = (MySqlCommand)value; }\r
+ }\r
+\r
+ #endregion\r
+\r
+ /*\r
+ * Implement abstract methods inherited from DbDataAdapter.\r
+ */\r
+ /// <summary>\r
+ /// Overridden. See <see cref="DbDataAdapter.CreateRowUpdatedEvent"/>.\r
+ /// </summary>\r
+ /// <param name="dataRow"></param>\r
+ /// <param name="command"></param>\r
+ /// <param name="statementType"></param>\r
+ /// <param name="tableMapping"></param>\r
+ /// <returns></returns>\r
+ override protected RowUpdatedEventArgs CreateRowUpdatedEvent(DataRow dataRow, IDbCommand command, StatementType statementType, DataTableMapping tableMapping)\r
+ {\r
+ return new MySqlRowUpdatedEventArgs(dataRow, command, statementType, tableMapping);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overridden. See <see cref="DbDataAdapter.CreateRowUpdatingEvent"/>.\r
+ /// </summary>\r
+ /// <param name="dataRow"></param>\r
+ /// <param name="command"></param>\r
+ /// <param name="statementType"></param>\r
+ /// <param name="tableMapping"></param>\r
+ /// <returns></returns>\r
+ override protected RowUpdatingEventArgs CreateRowUpdatingEvent(DataRow dataRow, IDbCommand command, StatementType statementType, DataTableMapping tableMapping)\r
+ {\r
+ return new MySqlRowUpdatingEventArgs(dataRow, command, statementType, tableMapping);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overridden. Raises the RowUpdating event.\r
+ /// </summary>\r
+ /// <param name="value">A MySqlRowUpdatingEventArgs that contains the event data.</param>\r
+ override protected void OnRowUpdating(RowUpdatingEventArgs value)\r
+ {\r
+ MySqlRowUpdatingEventHandler handler = (MySqlRowUpdatingEventHandler) Events[EventRowUpdating];\r
+ if ((null != handler) && (value is MySqlRowUpdatingEventArgs)) \r
+ {\r
+ handler(this, (MySqlRowUpdatingEventArgs) value);\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overridden. Raises the RowUpdated event.\r
+ /// </summary>\r
+ /// <param name="value">A MySqlRowUpdatedEventArgs that contains the event data. </param>\r
+ override protected void OnRowUpdated(RowUpdatedEventArgs value)\r
+ {\r
+ MySqlRowUpdatedEventHandler handler = (MySqlRowUpdatedEventHandler) Events[EventRowUpdated];\r
+ if ((null != handler) && (value is MySqlRowUpdatedEventArgs)) \r
+ {\r
+ handler(this, (MySqlRowUpdatedEventArgs) value);\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Occurs during Update before a command is executed against the data source. The attempt to update is made, so the event fires.\r
+ /// </summary>\r
+ public event MySqlRowUpdatingEventHandler RowUpdating\r
+ {\r
+ add { Events.AddHandler(EventRowUpdating, value); }\r
+ remove { Events.RemoveHandler(EventRowUpdating, value); }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Occurs during Update after a command is executed against the data source. The attempt to update is made, so the event fires.\r
+ /// </summary>\r
+ public event MySqlRowUpdatedEventHandler RowUpdated\r
+ {\r
+ add { Events.AddHandler(EventRowUpdated, value); }\r
+ remove { Events.RemoveHandler(EventRowUpdated, value); }\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Represents the method that will handle the <see cref="MySqlDataAdapter.RowUpdating"/> event of a <see cref="MySqlDataAdapter"/>.\r
+ /// </summary>\r
+ public delegate void MySqlRowUpdatingEventHandler(object sender, MySqlRowUpdatingEventArgs e);\r
+\r
+ /// <summary>\r
+ /// Represents the method that will handle the <see cref="MySqlDataAdapter.RowUpdated"/> event of a <see cref="MySqlDataAdapter"/>.\r
+ /// </summary>\r
+ public delegate void MySqlRowUpdatedEventHandler(object sender, MySqlRowUpdatedEventArgs e);\r
+\r
+ /// <summary>\r
+ /// Provides data for the RowUpdating event. This class cannot be inherited.\r
+ /// </summary>\r
+ public sealed class MySqlRowUpdatingEventArgs : RowUpdatingEventArgs\r
+ {\r
+ /// <summary>\r
+ /// Initializes a new instance of the MySqlRowUpdatingEventArgs class.\r
+ /// </summary>\r
+ /// <param name="row">The <see cref="DataRow"/> to <see cref="DbDataAdapter.Update"/>.</param>\r
+ /// <param name="command">The <see cref="IDbCommand"/> to execute during <see cref="DbDataAdapter.Update"/>.</param>\r
+ /// <param name="statementType">One of the <see cref="StatementType"/> values that specifies the type of query executed.</param>\r
+ /// <param name="tableMapping">The <see cref="DataTableMapping"/> sent through an <see cref="DbDataAdapter.Update"/>.</param>\r
+ public MySqlRowUpdatingEventArgs(DataRow row, IDbCommand command, StatementType statementType, DataTableMapping tableMapping) \r
+ : base(row, command, statementType, tableMapping) \r
+ {\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the MySqlCommand to execute when performing the Update.\r
+ /// </summary>\r
+ new public MySqlCommand Command\r
+ {\r
+ get { return (MySqlCommand)base.Command; }\r
+ set { base.Command = value; }\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Provides data for the RowUpdated event. This class cannot be inherited.\r
+ /// </summary>\r
+ public sealed class MySqlRowUpdatedEventArgs : RowUpdatedEventArgs\r
+ {\r
+ /// <summary>\r
+ /// Initializes a new instance of the MySqlRowUpdatedEventArgs class.\r
+ /// </summary>\r
+ /// <param name="row">The <see cref="DataRow"/> sent through an <see cref="DbDataAdapter.Update"/>.</param>\r
+ /// <param name="command">The <see cref="IDbCommand"/> executed when <see cref="DbDataAdapter.Update"/> is called.</param>\r
+ /// <param name="statementType">One of the <see cref="StatementType"/> values that specifies the type of query executed.</param>\r
+ /// <param name="tableMapping">The <see cref="DataTableMapping"/> sent through an <see cref="DbDataAdapter.Update"/>.</param>\r
+ public MySqlRowUpdatedEventArgs(DataRow row, IDbCommand command, StatementType statementType, DataTableMapping tableMapping)\r
+ : base(row, command, statementType, tableMapping) \r
+ {\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the MySqlCommand executed when Update is called.\r
+ /// </summary>\r
+ new public MySqlCommand Command\r
+ {\r
+ get { return (MySqlCommand)base.Command; }\r
+ }\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Data;
-using System.Collections;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Provides a means of reading a forward-only stream of rows from a MySQL database. This class cannot be inherited.
- /// </summary>
- /// <include file='docs/MySqlDataReader.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>
- public sealed class MySqlDataReader : MarshalByRefObject, IEnumerable, IDataReader, IDisposable, IDataRecord
- {
- // The DataReader should always be open when returned to the user.
- private bool isOpen = true;
-
- // Keep track of the results and position
- // within the resultset (starts prior to first record).
- private MySqlField[] _fields;
- private CommandBehavior commandBehavior;
- private MySqlCommand command;
- private bool canRead;
- private bool hasRows;
-
- /*
- * Keep track of the connection in order to implement the
- * CommandBehavior.CloseConnection flag. A null reference means
- * normal behavior (do not automatically close).
- */
- private MySqlConnection connection = null;
-
- /*
- * Because the user should not be able to directly create a
- * DataReader object, the constructors are
- * marked as internal.
- */
- internal MySqlDataReader( MySqlCommand cmd, CommandBehavior behavior)
- {
- this.command = cmd;
- connection = (MySqlConnection)command.Connection;
- commandBehavior = behavior;
- }
-
- /// <summary>
- /// Gets a value indicating the depth of nesting for the current row. This method is not
- /// supported currently and always returns 0.
- /// </summary>
- public int Depth
- {
- get { return 0; }
- }
-
- /// <summary>
- /// Gets a value indicating whether the data reader is closed.
- /// </summary>
- public bool IsClosed
- {
- get { return ! isOpen; }
- }
-
- void IDisposable.Dispose()
- {
- if (isOpen)
- Close();
- }
-
- /// <summary>
- /// Gets the number of rows changed, inserted, or deleted by execution of the SQL statement.
- /// </summary>
- public int RecordsAffected
- {
- // RecordsAffected returns the number of rows affected in batch
- // statments from insert/delete/update statments. This property
- // is not completely accurate until .Close() has been called.
- get { return command.UpdateCount; }
- }
-
- /// <summary>
- /// Gets a value indicating whether the MySqlDataReader contains one or more rows.
- /// </summary>
- public bool HasRows
- {
- get { return hasRows; }
- }
-
- /// <summary>
- /// Closes the MySqlDataReader object.
- /// </summary>
- public void Close()
- {
- // finish any current command
- ClearCurrentResult();
- command.ExecuteBatch(false);
- connection.InternalConnection.Driver.ClearPeekedPacket();
-
- connection.Reader = null;
- if (0 != (commandBehavior & CommandBehavior.CloseConnection))
- connection.Close();
-
- isOpen = false;
- }
-
-
-
-
- /// <summary>
- /// Gets the number of columns in the current row.
- /// </summary>
- public int FieldCount
- {
- // Return the count of the number of columns, which in
- // this case is the size of the column metadata
- // array.
- get
- {
- if (_fields != null)
- return _fields.Length;
- return 0;
- }
- }
-
- /// <summary>
- /// Overloaded. Gets the value of a column in its native format.
- /// In C#, this property is the indexer for the MySqlDataReader class.
- /// </summary>
- public object this [ int i ]
- {
- get
- {
- return this.GetValue(i);
- }
- }
-
- /// <summary>
- /// Gets the value of a column in its native format.
- /// [C#] In C#, this property is the indexer for the MySqlDataReader class.
- /// </summary>
- public object this [ String name ]
- {
- // Look up the ordinal and return
- // the value at that position.
- get { return this[GetOrdinal(name)]; }
- }
-
- private MySqlField GetField(int i)
- {
- if (i >= _fields.Length) throw new IndexOutOfRangeException();
- return _fields[i];
- }
-
- #region TypeSafe Accessors
- /// <summary>
- /// Gets the value of the specified column as a Boolean.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public bool GetBoolean(int i)
- {
- return Convert.ToBoolean(GetValue(i));
- }
-
- /// <summary>
- /// Gets the value of the specified column as a byte.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public byte GetByte(int i)
- {
- return Convert.ToByte(GetValue(i));
- }
-
- /// <summary>
- /// Reads a stream of bytes from the specified column offset into the buffer an array starting at the given buffer offset.
- /// </summary>
- /// <param name="i">The zero-based column ordinal. </param>
- /// <param name="dataIndex">The index within the field from which to begin the read operation. </param>
- /// <param name="buffer">The buffer into which to read the stream of bytes. </param>
- /// <param name="bufferIndex">The index for buffer to begin the read operation. </param>
- /// <param name="length">The maximum length to copy into the buffer. </param>
- /// <returns>The actual number of bytes read.</returns>
- public long GetBytes(int i, long dataIndex, byte[] buffer, int bufferIndex, int length)
- {
- if (i >= _fields.Length)
- throw new IndexOutOfRangeException();
-
- byte[] bytes = (byte[])GetValue(i);
-
- if (buffer == null)
- return bytes.Length;
-
- // adjust the length so we don't run off the end
- if (bytes.Length < (dataIndex+length))
- {
- length = (int)(bytes.Length - dataIndex);
- }
-
- for (int x=0; x < length; x++)
- {
- buffer[bufferIndex+x] = bytes[dataIndex+x];
- }
-
- return length;
- }
-
- /// <summary>
- /// Gets the value of the specified column as a single character.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public char GetChar(int i)
- {
- return Convert.ToChar(GetValue(i));
- }
-
- /// <summary>
- /// Reads a stream of characters from the specified column offset into the buffer as an array starting at the given buffer offset.
- /// </summary>
- /// <param name="i"></param>
- /// <param name="fieldOffset"></param>
- /// <param name="buffer"></param>
- /// <param name="bufferoffset"></param>
- /// <param name="length"></param>
- /// <returns></returns>
- public long GetChars(int i, long fieldOffset, char[] buffer, int bufferoffset, int length)
- {
- if (i >= _fields.Length)
- throw new IndexOutOfRangeException();
-
- // retrieve the bytes of the column
- long bytesize = GetBytes(i, 0, null, 0, 0);
- byte[] bytes = new byte[bytesize];
- GetBytes(i, 0, bytes, 0, (int)bytesize);
-
- char[] chars = System.Text.Encoding.UTF8.GetChars(bytes, 0, (int)bytesize);
-
- if (buffer == null)
- return chars.Length;
-
- // adjust the length so we don't run off the end
- if (chars.Length < (fieldOffset+length))
- {
- length = (int)(chars.Length - fieldOffset);
- }
-
- for (int x=0; x < length; x++)
- {
- buffer[bufferoffset+x] = chars[fieldOffset+x];
- }
-
- return length;
- }
-
- /// <summary>
- /// Gets the name of the source data type.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public String GetDataTypeName(int i)
- {
- if (! isOpen) throw new Exception("No current query in data reader");
- if (i >= _fields.Length) throw new IndexOutOfRangeException();
-
- // return the name of the type used on the backend
- return _fields[i].GetFieldTypeName();
- }
-
- /// <summary>
- /// Gets the value of the specified column as a DateTime object.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public DateTime GetDateTime(int i)
- {
- return Convert.ToDateTime(GetValue(i));
- }
-
- /// <summary>
- /// Gets the value of the specified column as a Decimal object.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public Decimal GetDecimal(int i)
- {
- return Convert.ToDecimal(GetValue(i));
- }
-
- /// <summary>
- /// Gets the value of the specified column as a double-precision floating point number.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public double GetDouble(int i)
- {
- return Convert.ToDouble(GetValue(i));
- }
-
- /// <summary>
- /// Gets the Type that is the data type of the object.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public Type GetFieldType(int i)
- {
- if (! isOpen) throw new Exception("No current query in data reader");
- if (i >= _fields.Length) throw new IndexOutOfRangeException();
-
- return _fields[i].GetFieldType();
- }
-
- /// <summary>
- /// Gets the value of the specified column as a single-precision floating point number.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public float GetFloat(int i)
- {
- return Convert.ToSingle(GetValue(i));
- }
-
- /// <summary>
- /// Gets the value of the specified column as a globally-unique identifier (GUID).
- /// This is currently not supported.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public Guid GetGuid(int i)
- {
- /*
- * Force the cast to return the type. InvalidCastException
- * should be thrown if the data is not already of the correct type.
- */
- // The sample does not support this method.
- throw new NotSupportedException("GetGUID not supported.");
- }
-
- /// <summary>
- /// Gets the value of the specified column as a 16-bit signed integer.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public Int16 GetInt16(int i)
- {
- return Convert.ToInt16(GetValue(i));
- }
-
- /// <summary>
- /// Gets the value of the specified column as a 32-bit signed integer.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public Int32 GetInt32(int i)
- {
- return Convert.ToInt32(GetValue(i));
- }
-
- /// <summary>
- /// Gets the value of the specified column as a 64-bit signed integer.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public Int64 GetInt64(int i)
- {
- return Convert.ToInt64(GetValue(i));
- }
-
- /// <summary>
- /// Gets the name of the specified column.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public String GetName(int i)
- {
- return _fields[i].ColumnName;
- }
-
- /// <summary>
- /// Gets the column ordinal, given the name of the column.
- /// </summary>
- /// <param name="name"></param>
- /// <returns></returns>
- public int GetOrdinal(string name)
- {
- if (! isOpen)
- throw new Exception("No current query in data reader");
-
- for (int i=0; i < _fields.Length; i ++)
- {
- if (_fields[i].ColumnName.ToLower().Equals(name.ToLower()))
- return i;
- }
-
- // Throw an exception if the ordinal cannot be found.
- throw new IndexOutOfRangeException("Could not find specified column in results");
- }
-
- /// <summary>
- /// Returns a DataTable that describes the column metadata of the MySqlDataReader.
- /// </summary>
- /// <returns></returns>
- public DataTable GetSchemaTable()
- {
- // Only Results from SQL SELECT Queries
- // get a DataTable for schema of the result
- // otherwise, DataTable is null reference
- if (_fields.Length == 0) return null;
-
- DataTable dataTableSchema = new DataTable ("SchemaTable");
-
- dataTableSchema.Columns.Add ("ColumnName", typeof (string));
- dataTableSchema.Columns.Add ("ColumnOrdinal", typeof (int));
- dataTableSchema.Columns.Add ("ColumnSize", typeof (int));
- dataTableSchema.Columns.Add ("NumericPrecision", typeof (int));
- dataTableSchema.Columns.Add ("NumericScale", typeof (int));
- dataTableSchema.Columns.Add ("IsUnique", typeof (bool));
- dataTableSchema.Columns.Add ("IsKey", typeof (bool));
- DataColumn dc = dataTableSchema.Columns["IsKey"];
- dc.AllowDBNull = true; // IsKey can have a DBNull
- dataTableSchema.Columns.Add ("BaseCatalogName", typeof (string));
- dataTableSchema.Columns.Add ("BaseColumnName", typeof (string));
- dataTableSchema.Columns.Add ("BaseSchemaName", typeof (string));
- dataTableSchema.Columns.Add ("BaseTableName", typeof (string));
- dataTableSchema.Columns.Add ("DataType", typeof(Type));
- dataTableSchema.Columns.Add ("AllowDBNull", typeof (bool));
- dataTableSchema.Columns.Add ("ProviderType", typeof (int));
- dataTableSchema.Columns.Add ("IsAliased", typeof (bool));
- dataTableSchema.Columns.Add ("IsExpression", typeof (bool));
- dataTableSchema.Columns.Add ("IsIdentity", typeof (bool));
- dataTableSchema.Columns.Add ("IsAutoIncrement", typeof (bool));
- dataTableSchema.Columns.Add ("IsRowVersion", typeof (bool));
- dataTableSchema.Columns.Add ("IsHidden", typeof (bool));
- dataTableSchema.Columns.Add ("IsLong", typeof (bool));
- dataTableSchema.Columns.Add ("IsReadOnly", typeof (bool));
-
- int ord = 1;
- foreach (MySqlField f in _fields)
- {
- DataRow r = dataTableSchema.NewRow();
- r["ColumnName"] = f.ColumnName;
- r["ColumnOrdinal"] = ord++;
- r["ColumnSize"] = f.ColumnLength;
- int prec = f.NumericPrecision();
- int pscale = f.NumericScale();
- if (prec != -1)
- r["NumericPrecision"] = (short)prec;
- if (pscale != -1)
- r["NumericScale"] = (short)pscale;
- r["DataType"] = f.GetFieldType();
- r["ProviderType"] = (int)f.GetMySqlDbType();
- r["IsLong"] = f.IsBlob() && f.ColumnLength > 255;
- r["AllowDBNull"] = f.AllowsNull();
- r["IsReadOnly"] = false;
- r["IsRowVersion"] = false;
- r["IsUnique"] = f.IsUnique();
- r["IsKey"] = f.IsPrimaryKey();
- r["IsAutoIncrement"] = f.IsAutoIncrement();
- r["BaseSchemaName"] = null;
- r["BaseCatalogName"] = null;
- r["BaseTableName"] = f.TableName;
- r["BaseColumnName"] = f.ColumnName;
-
- dataTableSchema.Rows.Add( r );
- }
-
- return dataTableSchema;
- }
-
- /// <summary>
- /// Gets the value of the specified column as a string.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public String GetString(int i)
- {
- return GetValue(i).ToString();
- }
-
- /// <summary>
- /// Gets the value of the specified column in its native format.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public object GetValue(int i)
- {
- if (! isOpen) throw new Exception("No current query in data reader");
- if (i >= _fields.Length) throw new IndexOutOfRangeException();
-
- return _fields[i].GetValue();
- }
-
- /// <summary>
- /// Gets all attribute columns in the collection for the current row.
- /// </summary>
- /// <param name="values"></param>
- /// <returns></returns>
- public int GetValues(object[] values)
- {
- for (int i=0; i < _fields.Length; i ++)
- {
- values[i] = GetValue(i);
- }
-
- return 0;
- }
-
-
- /// <summary>
- /// Gets the value of the specified column as a 16-bit unsigned integer.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public UInt16 GetUInt16( int i )
- {
- return Convert.ToUInt16(GetValue(i));
- }
-
- /// <summary>
- /// Gets the value of the specified column as a 32-bit unsigned integer.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public UInt32 GetUInt32( int i )
- {
- return Convert.ToUInt32(GetValue(i));
- }
-
- /// <summary>
- /// Gets the value of the specified column as a 64-bit unsigned integer.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public UInt64 GetUInt64( int i )
- {
- return Convert.ToUInt64(GetValue(i));
- }
-
-
- #endregion
-
- IDataReader IDataRecord.GetData(int i)
- {
- throw new NotSupportedException("GetData not supported.");
- }
-
- /// <summary>
- /// Gets a value indicating whether the column contains non-existent or missing values.
- /// </summary>
- /// <param name="i"></param>
- /// <returns></returns>
- public bool IsDBNull(int i)
- {
- return DBNull.Value == GetValue(i);
- }
-
- /// <summary>
- /// Advances the data reader to the next result, when reading the results of batch SQL statements.
- /// </summary>
- /// <returns></returns>
- public bool NextResult()
- {
- if (! isOpen)
- throw new MySqlException("Invalid attempt to NextResult when reader is closed.");
-
- Driver driver = connection.InternalConnection.Driver;
-
- // clear any rows that have not been read from the last rowset
- ClearCurrentResult();
-
- // tell our command to continue execution of the SQL batch until it its
- // another resultset
- Packet packet = command.ExecuteBatch(true);
-
- // if there was no more resultsets, then signal done
- if (packet == null)
- {
- canRead = false;
- return false;
- }
-
- // When executing query statements, the result byte that is returned
- // from MySql is the column count. That is why we reference the LastResult
- // property here to dimension our field array
- connection.SetState( ConnectionState.Fetching );
-
- _fields = new MySqlField[ packet.ReadLenInteger() ];
- for (int x=0; x < _fields.Length; x++)
- {
- packet = driver.ReadPacket();
- _fields[x] = new MySqlField();
- _fields[x].ReadSchemaInfo( packet );
- }
-
- // read off the end of schema packet
- packet = driver.ReadPacket();
- if ( ! packet.IsLastPacket())
- throw new MySqlException("Expected end of schema packet");
-
- // now take a quick peek at the next packet to see if we have rows
- //
- packet = driver.PeekPacket();
- hasRows = ! packet.IsLastPacket();
- canRead = hasRows;
-
- connection.SetState( ConnectionState.Open );
- return true;
- }
-
- /// <summary>
- /// Advances the MySqlDataReader to the next record.
- /// </summary>
- /// <returns></returns>
- public bool Read()
- {
- if (! isOpen)
- throw new MySqlException("Invalid attempt to Read when reader is closed.");
-
- if (! canRead) return false;
-
- Driver driver = connection.InternalConnection.Driver;
- connection.SetState( ConnectionState.Fetching );
-
- try
- {
- Packet rowPacket = driver.ReadPacket();
- if (rowPacket.IsLastPacket())
- {
- canRead = false;
- return false;
- }
- rowPacket.Position = 0;
-
- for (int col=0; col < _fields.Length; col++)
- {
- _fields[col].SetValueData( rowPacket, driver.Encoding );
- }
- }
- catch (Exception ex)
- {
- System.Diagnostics.Trace.WriteLine("MySql error: " + ex.Message);
- throw ex;
- }
- finally
- {
- connection.SetState( ConnectionState.Open );
- }
- return true;
- }
-
-
- /*
- * Implementation specific methods.
- */
- private int _cultureAwareCompare(string strA, string strB)
- {
- // return CultureInfo.CurrentCulture.CompareInfo.Compare(strA, strB, CompareOptions.IgnoreKanaType | CompareOptions.IgnoreWidth | CompareOptions.IgnoreCase);
- return 0;
- }
-
- #region Private Methods
-
- private void ClearCurrentResult()
- {
- if (! canRead) return;
-
- Driver driver = connection.InternalConnection.Driver;
-
- Packet packet = driver.ReadPacket();
- // clean out any current resultset
- while (! packet.IsLastPacket())
- packet = driver.ReadPacket();
- }
-
- #endregion
-
- #region IEnumerator
- IEnumerator IEnumerable.GetEnumerator()
- {
- return new System.Data.Common.DbEnumerator(this);
- }
- #endregion
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Data;\r
+using System.Collections;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Provides a means of reading a forward-only stream of rows from a MySQL database. This class cannot be inherited.\r
+ /// </summary>\r
+ /// <include file='docs/MySqlDataReader.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>\r
+ public sealed class MySqlDataReader : MarshalByRefObject, IEnumerable, IDataReader, IDisposable, IDataRecord\r
+ {\r
+ // The DataReader should always be open when returned to the user.\r
+ private bool isOpen = true;\r
+\r
+ // Keep track of the results and position\r
+ // within the resultset (starts prior to first record).\r
+ private MySqlField[] _fields;\r
+ private CommandBehavior commandBehavior;\r
+ private MySqlCommand command;\r
+ private bool canRead;\r
+ private bool hasRows;\r
+ private CommandResult currentResult;\r
+\r
+ /* \r
+ * Keep track of the connection in order to implement the\r
+ * CommandBehavior.CloseConnection flag. A null reference means\r
+ * normal behavior (do not automatically close).\r
+ */\r
+ private MySqlConnection connection = null;\r
+\r
+ /*\r
+ * Because the user should not be able to directly create a \r
+ * DataReader object, the constructors are\r
+ * marked as internal.\r
+ */\r
+ internal MySqlDataReader( MySqlCommand cmd, CommandBehavior behavior)\r
+ {\r
+ this.command = cmd;\r
+ connection = (MySqlConnection)command.Connection;\r
+ commandBehavior = behavior;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets a value indicating the depth of nesting for the current row. This method is not \r
+ /// supported currently and always returns 0.\r
+ /// </summary>\r
+ public int Depth \r
+ {\r
+ get { return 0; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets a value indicating whether the data reader is closed.\r
+ /// </summary>\r
+ public bool IsClosed\r
+ {\r
+ get { return ! isOpen; }\r
+ }\r
+\r
+ void IDisposable.Dispose() \r
+ {\r
+ if (isOpen)\r
+ Close();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the number of rows changed, inserted, or deleted by execution of the SQL statement.\r
+ /// </summary>\r
+ public int RecordsAffected \r
+ {\r
+ // RecordsAffected returns the number of rows affected in batch\r
+ // statments from insert/delete/update statments. This property\r
+ // is not completely accurate until .Close() has been called.\r
+ get { return command.UpdateCount; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets a value indicating whether the MySqlDataReader contains one or more rows.\r
+ /// </summary>\r
+ public bool HasRows\r
+ {\r
+ get { return hasRows; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Closes the MySqlDataReader object.\r
+ /// </summary>\r
+ public void Close()\r
+ {\r
+ if (! isOpen) return;\r
+\r
+ // finish any current command\r
+ if (currentResult != null)\r
+ currentResult.Clear();\r
+ command.ExecuteBatch(false);\r
+\r
+ connection.Reader = null;\r
+ if (0 != (commandBehavior & CommandBehavior.CloseConnection))\r
+ connection.Close();\r
+\r
+ isOpen = false;\r
+ }\r
+\r
+\r
+\r
+\r
+ /// <summary>\r
+ /// Gets the number of columns in the current row.\r
+ /// </summary>\r
+ public int FieldCount\r
+ {\r
+ // Return the count of the number of columns, which in\r
+ // this case is the size of the column metadata\r
+ // array.\r
+ get \r
+ { \r
+ if (_fields != null)\r
+ return _fields.Length;\r
+ return 0;\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overloaded. Gets the value of a column in its native format.\r
+ /// In C#, this property is the indexer for the MySqlDataReader class.\r
+ /// </summary>\r
+ public object this [ int i ]\r
+ {\r
+ get \r
+ {\r
+ return this.GetValue(i);\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of a column in its native format.\r
+ /// [C#] In C#, this property is the indexer for the MySqlDataReader class.\r
+ /// </summary>\r
+ public object this [ String name ]\r
+ {\r
+ // Look up the ordinal and return \r
+ // the value at that position.\r
+ get { return this[GetOrdinal(name)]; }\r
+ }\r
+\r
+ private MySqlField GetField(int i)\r
+ {\r
+ if (i >= _fields.Length) throw new IndexOutOfRangeException();\r
+ return _fields[i];\r
+ }\r
+\r
+ #region TypeSafe Accessors\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a Boolean.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public bool GetBoolean(int i)\r
+ {\r
+ return Convert.ToBoolean(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a byte.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public byte GetByte(int i)\r
+ {\r
+ return Convert.ToByte(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Reads a stream of bytes from the specified column offset into the buffer an array starting at the given buffer offset.\r
+ /// </summary>\r
+ /// <param name="i">The zero-based column ordinal. </param>\r
+ /// <param name="dataIndex">The index within the field from which to begin the read operation. </param>\r
+ /// <param name="buffer">The buffer into which to read the stream of bytes. </param>\r
+ /// <param name="bufferIndex">The index for buffer to begin the read operation. </param>\r
+ /// <param name="length">The maximum length to copy into the buffer. </param>\r
+ /// <returns>The actual number of bytes read.</returns>\r
+ public long GetBytes(int i, long dataIndex, byte[] buffer, int bufferIndex, int length)\r
+ {\r
+ if (i >= _fields.Length) \r
+ throw new IndexOutOfRangeException();\r
+\r
+ long bufLen = _fields[i].BufferLength;\r
+\r
+ if (buffer == null) \r
+ return bufLen;\r
+\r
+ if (bufferIndex >= buffer.Length || bufferIndex < 0)\r
+ throw new IndexOutOfRangeException("Buffer index must be a valid index in buffer");\r
+ if (buffer.Length < (bufferIndex + length))\r
+ throw new ArgumentException( "Buffer is not large enough to hold the requested data" );\r
+ if (dataIndex < 0 || dataIndex >= bufLen )\r
+ throw new IndexOutOfRangeException( "Data index must be a valid index in the field" );\r
+\r
+ byte[] bytes = _fields[i].Buffer;\r
+ long fieldIndex = _fields[i].BufferIndex;\r
+\r
+ // adjust the length so we don't run off the end\r
+ if ( bufLen < (dataIndex+length)) \r
+ {\r
+ length = (int)((long)bytes.Length - dataIndex);\r
+ }\r
+\r
+ for (long x=0; x < length; x++)\r
+ {\r
+ buffer[bufferIndex+x] = bytes[fieldIndex+dataIndex+x]; \r
+ }\r
+\r
+ return length;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a single character.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public char GetChar(int i)\r
+ {\r
+ return Convert.ToChar(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Reads a stream of characters from the specified column offset into the buffer as an array starting at the given buffer offset.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <param name="fieldOffset"></param>\r
+ /// <param name="buffer"></param>\r
+ /// <param name="bufferoffset"></param>\r
+ /// <param name="length"></param>\r
+ /// <returns></returns>\r
+ public long GetChars(int i, long fieldOffset, char[] buffer, int bufferoffset, int length)\r
+ {\r
+ if (i >= _fields.Length) \r
+ throw new IndexOutOfRangeException();\r
+\r
+ // retrieve the bytes of the column\r
+ long bytesize = GetBytes(i, 0, null, 0, 0);\r
+ byte[] bytes = new byte[bytesize];\r
+ GetBytes(i, 0, bytes, 0, (int)bytesize);\r
+\r
+ char[] chars = System.Text.Encoding.UTF8.GetChars(bytes, 0, (int)bytesize);\r
+\r
+ if (buffer == null) \r
+ return chars.Length;\r
+\r
+ // adjust the length so we don't run off the end\r
+ if (chars.Length < (fieldOffset+length)) \r
+ {\r
+ length = (int)(chars.Length - fieldOffset);\r
+ }\r
+\r
+ for (int x=0; x < length; x++)\r
+ {\r
+ buffer[bufferoffset+x] = chars[fieldOffset+x]; \r
+ }\r
+\r
+ return length;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the name of the source data type.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public String GetDataTypeName(int i)\r
+ {\r
+ if (! isOpen) throw new Exception("No current query in data reader");\r
+ if (i >= _fields.Length) throw new IndexOutOfRangeException();\r
+\r
+ // return the name of the type used on the backend\r
+ return _fields[i].GetFieldTypeName();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a DateTime object.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public DateTime GetDateTime(int i)\r
+ {\r
+ return Convert.ToDateTime(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a Decimal object.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public Decimal GetDecimal(int i)\r
+ {\r
+ return Convert.ToDecimal(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a double-precision floating point number.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public double GetDouble(int i)\r
+ {\r
+ return Convert.ToDouble(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the Type that is the data type of the object.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public Type GetFieldType(int i)\r
+ {\r
+ if (! isOpen) throw new Exception("No current query in data reader");\r
+ if (i >= _fields.Length) throw new IndexOutOfRangeException();\r
+\r
+ return _fields[i].GetFieldType();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a single-precision floating point number.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public float GetFloat(int i)\r
+ {\r
+ return Convert.ToSingle(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a globally-unique identifier (GUID).\r
+ /// This is currently not supported.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public Guid GetGuid(int i)\r
+ {\r
+ return new Guid( GetString(i) );\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a 16-bit signed integer.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public Int16 GetInt16(int i)\r
+ {\r
+ return Convert.ToInt16(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a 32-bit signed integer.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public Int32 GetInt32(int i)\r
+ {\r
+ return Convert.ToInt32(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a 64-bit signed integer.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public Int64 GetInt64(int i)\r
+ {\r
+ return Convert.ToInt64(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the name of the specified column.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public String GetName(int i)\r
+ {\r
+ return _fields[i].ColumnName;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the column ordinal, given the name of the column.\r
+ /// </summary>\r
+ /// <param name="name"></param>\r
+ /// <returns></returns>\r
+ public int GetOrdinal(string name)\r
+ {\r
+ if (! isOpen)\r
+ throw new Exception("No current query in data reader");\r
+\r
+ for (int i=0; i < _fields.Length; i ++) \r
+ {\r
+ if (_fields[i].ColumnName.ToLower().Equals(name.ToLower()))\r
+ return i;\r
+ }\r
+\r
+ // Throw an exception if the ordinal cannot be found.\r
+ throw new IndexOutOfRangeException("Could not find specified column in results");\r
+ }\r
+\r
+ /// <summary>\r
+ /// Returns a DataTable that describes the column metadata of the MySqlDataReader.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public DataTable GetSchemaTable()\r
+ {\r
+ // Only Results from SQL SELECT Queries \r
+ // get a DataTable for schema of the result\r
+ // otherwise, DataTable is null reference\r
+ if (_fields.Length == 0) return null;\r
+\r
+ DataTable dataTableSchema = new DataTable ("SchemaTable");\r
+ \r
+ dataTableSchema.Columns.Add ("ColumnName", typeof (string));\r
+ dataTableSchema.Columns.Add ("ColumnOrdinal", typeof (int));\r
+ dataTableSchema.Columns.Add ("ColumnSize", typeof (int));\r
+ dataTableSchema.Columns.Add ("NumericPrecision", typeof (int));\r
+ dataTableSchema.Columns.Add ("NumericScale", typeof (int));\r
+ dataTableSchema.Columns.Add ("IsUnique", typeof (bool));\r
+ dataTableSchema.Columns.Add ("IsKey", typeof (bool));\r
+ DataColumn dc = dataTableSchema.Columns["IsKey"];\r
+ dc.AllowDBNull = true; // IsKey can have a DBNull\r
+ dataTableSchema.Columns.Add ("BaseCatalogName", typeof (string));\r
+ dataTableSchema.Columns.Add ("BaseColumnName", typeof (string));\r
+ dataTableSchema.Columns.Add ("BaseSchemaName", typeof (string));\r
+ dataTableSchema.Columns.Add ("BaseTableName", typeof (string));\r
+ dataTableSchema.Columns.Add ("DataType", typeof(Type));\r
+ dataTableSchema.Columns.Add ("AllowDBNull", typeof (bool));\r
+ dataTableSchema.Columns.Add ("ProviderType", typeof (int));\r
+ dataTableSchema.Columns.Add ("IsAliased", typeof (bool));\r
+ dataTableSchema.Columns.Add ("IsExpression", typeof (bool));\r
+ dataTableSchema.Columns.Add ("IsIdentity", typeof (bool));\r
+ dataTableSchema.Columns.Add ("IsAutoIncrement", typeof (bool));\r
+ dataTableSchema.Columns.Add ("IsRowVersion", typeof (bool));\r
+ dataTableSchema.Columns.Add ("IsHidden", typeof (bool));\r
+ dataTableSchema.Columns.Add ("IsLong", typeof (bool));\r
+ dataTableSchema.Columns.Add ("IsReadOnly", typeof (bool));\r
+\r
+ int ord = 1;\r
+ foreach (MySqlField f in _fields)\r
+ {\r
+ DataRow r = dataTableSchema.NewRow();\r
+ r["ColumnName"] = f.ColumnName;\r
+ r["ColumnOrdinal"] = ord++;\r
+ r["ColumnSize"] = f.ColumnLength;\r
+ int prec = f.NumericPrecision;\r
+ int pscale = f.NumericScale;\r
+ if (prec != -1)\r
+ r["NumericPrecision"] = (short)prec;\r
+ if (pscale != -1)\r
+ r["NumericScale"] = (short)pscale;\r
+ r["DataType"] = f.GetFieldType();\r
+ r["ProviderType"] = (int)f.Type;\r
+ r["IsLong"] = f.IsBlob() && f.ColumnLength > 255;\r
+ r["AllowDBNull"] = f.AllowsNull();\r
+ r["IsReadOnly"] = false;\r
+ r["IsRowVersion"] = false;\r
+ r["IsUnique"] = f.IsUnique();\r
+ r["IsKey"] = f.IsPrimaryKey();\r
+ r["IsAutoIncrement"] = f.IsAutoIncrement();\r
+ r["BaseSchemaName"] = null;\r
+ r["BaseCatalogName"] = null;\r
+ r["BaseTableName"] = f.TableName;\r
+ r["BaseColumnName"] = f.ColumnName;\r
+\r
+ dataTableSchema.Rows.Add( r );\r
+ }\r
+\r
+ return dataTableSchema;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a string.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public String GetString(int i)\r
+ {\r
+ return GetValue(i).ToString();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column in its native format.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public object GetValue(int i)\r
+ {\r
+ if (! isOpen) throw new Exception("No current query in data reader");\r
+ if (i >= _fields.Length) throw new IndexOutOfRangeException();\r
+\r
+ return _fields[i].GetValue();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets all attribute columns in the collection for the current row.\r
+ /// </summary>\r
+ /// <param name="values"></param>\r
+ /// <returns></returns>\r
+ public int GetValues(object[] values)\r
+ {\r
+ for (int i=0; i < _fields.Length; i ++) \r
+ {\r
+ values[i] = GetValue(i);\r
+ }\r
+\r
+ return 0;\r
+ }\r
+\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a 16-bit unsigned integer.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public UInt16 GetUInt16( int i )\r
+ {\r
+ return Convert.ToUInt16(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a 32-bit unsigned integer.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public UInt32 GetUInt32( int i )\r
+ {\r
+ return Convert.ToUInt32(GetValue(i));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the value of the specified column as a 64-bit unsigned integer.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public UInt64 GetUInt64( int i )\r
+ {\r
+ return Convert.ToUInt64(GetValue(i));\r
+ }\r
+\r
+\r
+ #endregion\r
+\r
+ IDataReader IDataRecord.GetData(int i)\r
+ {\r
+ throw new NotSupportedException("GetData not supported.");\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets a value indicating whether the column contains non-existent or missing values.\r
+ /// </summary>\r
+ /// <param name="i"></param>\r
+ /// <returns></returns>\r
+ public bool IsDBNull(int i)\r
+ {\r
+ return DBNull.Value == GetValue(i);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Advances the data reader to the next result, when reading the results of batch SQL statements.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public bool NextResult()\r
+ {\r
+ if (! isOpen)\r
+ throw new MySqlException("Invalid attempt to NextResult when reader is closed.");\r
+\r
+ // clear any rows that have not been read from the last rowset\r
+ if (currentResult != null)\r
+ currentResult.Clear();\r
+\r
+ // tell our command to continue execution of the SQL batch until it its\r
+ // another resultset\r
+ currentResult = command.ExecuteBatch(true);\r
+\r
+ // if there was no more resultsets, then signal done\r
+ if (currentResult == null) \r
+ {\r
+ canRead = false;\r
+ return false;\r
+ }\r
+\r
+ // When executing query statements, the result byte that is returned\r
+ // from MySql is the column count. That is why we reference the LastResult\r
+ // property here to dimension our field array\r
+ connection.SetState( ConnectionState.Fetching );\r
+ \r
+ _fields = new MySqlField[ currentResult.ColumnCount ];\r
+ for (int x=0; x < _fields.Length; x++) \r
+ _fields[x] = currentResult.GetField();\r
+\r
+ hasRows = currentResult.CheckForRows();\r
+ canRead = hasRows; \r
+\r
+ connection.SetState( ConnectionState.Open );\r
+ return true;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Advances the MySqlDataReader to the next record.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public bool Read()\r
+ {\r
+ if (! isOpen)\r
+ throw new MySqlException("Invalid attempt to Read when reader is closed.");\r
+\r
+ if (! canRead) return false;\r
+\r
+ Driver driver = connection.InternalConnection.Driver;\r
+ connection.SetState( ConnectionState.Fetching );\r
+\r
+ try \r
+ {\r
+ if (! currentResult.ReadDataRow())\r
+ {\r
+ canRead = false;\r
+ return false;\r
+ }\r
+\r
+ for (int col=0; col < _fields.Length; col++)\r
+ {\r
+ byte[] buf = currentResult.GetFieldBuffer();\r
+ int index = currentResult.GetFieldIndex();\r
+ long len = currentResult.GetFieldLength();\r
+ _fields[col].SetValueData( buf, index, len, driver.Version );\r
+ currentResult.NextField();\r
+ }\r
+ }\r
+ catch (Exception ex)\r
+ {\r
+ System.Diagnostics.Trace.WriteLine("MySql error: " + ex.Message);\r
+ throw ex;\r
+ }\r
+ finally \r
+ {\r
+ connection.SetState( ConnectionState.Open );\r
+ }\r
+ return true;\r
+ }\r
+\r
+\r
+ /*\r
+ * Implementation specific methods.\r
+ */\r
+ private int _cultureAwareCompare(string strA, string strB)\r
+ {\r
+ // return CultureInfo.CurrentCulture.CompareInfo.Compare(strA, strB, CompareOptions.IgnoreKanaType | CompareOptions.IgnoreWidth | CompareOptions.IgnoreCase);\r
+ return 0;\r
+ }\r
+\r
+\r
+ #region IEnumerator\r
+ IEnumerator IEnumerable.GetEnumerator()\r
+ {\r
+ return new System.Data.Common.DbEnumerator(this);\r
+ }\r
+ #endregion\r
+ }\r
+}\r
--- /dev/null
+<MyDocs>\r
+<MyMembers name="Class">\r
+<remarks>\r
+<B>MySqlCommand</B> features the following methods for executing commands at a MySQL database:\r
+<list type="table">\r
+ <listheader><term>Item</term><term>Description</term></listheader>\r
+ <item>\r
+ <term><a href="ByteFX.Data.MySqlClient.MySqlCommand.ExecuteReader_overloads.html">ExecuteReader</a></term>\r
+ <description>Executes commands that return rows.</description>\r
+ </item>\r
+ <item>\r
+ <term><a href="ByteFX.Data.MySqlClient.MySqlCommand.ExecuteNonQuery.html">ExecuteNonQuery</a></term>\r
+ <description>Executes commands such as SQL INSERT, DELETE, and UPDATE statements.</description>\r
+ </item>\r
+ <item>\r
+ <term><a href="ByteFX.Data.MySqlClient.MySqlCommand.ExecuteScalar.html">ExecuteScalar</a></term>\r
+ <description>Retrieves a single value (for example, an aggregate value) from a database.</description>\r
+ </item>\r
+</list>\r
+\r
+You can reset the <B>CommandText</B> property and reuse the <B>MySqlCommand</B> \r
+object. However, you must close the <A \r
+href="ByteFX.Data.MySqlClient.MySqlDataReader.html">MySqlDataReader</A> \r
+before you can execute a new or previous command.\r
+\r
+If a <A href="ByteFX.Data.MySqlClient.MySqlException.html">MySqlException</A> is \r
+generated by the method executing a <B>MySqlCommand</B>, the <A \r
+href="ByteFX.Data.MySqlClient.MySqlConnection.html">MySqlConnection</A> \r
+remains open. It is the responsibility of the programmer to close the connection.\r
+</remarks>\r
+\r
+<example>\r
+ The following example creates a <A href="frlrfsystemdatasqlclientsqlcommandclasstopic.htm">MySqlCommand</A> and \r
+ a <B>MySqlConnection</B>. The <B>MySqlConnection</B> is opened and set as the <A \r
+ href="frlrfsystemdatasqlclientsqlcommandclassconnectiontopic.htm">Connection</A> \r
+ for the <B>MySqlCommand</B>. The example then calls <A \r
+ href="frlrfsystemdatasqlclientsqlcommandclassexecutenonquerytopic.htm">ExecuteNonQuery</A>, \r
+ and closes the connection. To accomplish this, the <B>ExecuteNonQuery</B> is \r
+ passed a connection string and a query string that is a SQL INSERT \r
+ statement.\r
+ <code lang="Visual Basic">\r
+Public Sub InsertRow(myConnectionString As String)\r
+ ' If the connection string is null, use a default.\r
+ If myConnectionString = "" Then\r
+ myConnectionString = "Database=Test;Data Source=localhost;User Id=username;Password=pass"\r
+ End If\r
+ Dim myConnection As New MySqlConnection(myConnectionString)\r
+ Dim myInsertQuery As String = "INSERT INTO Orders (id, customerId, amount) Values(1001, 23, 30.66)"\r
+ Dim myCommand As New MySqlCommand(myInsertQuery)\r
+ myCommand.Connection = myConnection\r
+ myConnection.Open()\r
+ myCommand.ExecuteNonQuery()\r
+ myCommand.Connection.Close()\r
+End Sub\r
+ </code>\r
+ <code lang="C#">\r
+public void InsertRow(string myConnectionString) \r
+{\r
+ // If the connection string is null, use a default.\r
+ if(myConnectionString == "") \r
+ {\r
+ myConnectionString = "Database=Test;Data Source=localhost;User Id=username;Password=pass";\r
+ }\r
+ MySqlConnection myConnection = new MySqlConnection(myConnectionString);\r
+ string myInsertQuery = "INSERT INTO Orders (id, customerId, amount) Values(1001, 23, 30.66)";\r
+ MySqlCommand myCommand = new MySqlCommand(myInsertQuery);\r
+ myCommand.Connection = myConnection;\r
+ myConnection.Open();\r
+ myCommand.ExecuteNonQuery();\r
+ myCommand.Connection.Close();\r
+}\r
+ </code>\r
+</example>\r
+\r
+\r
+</MyMembers>\r
+\r
+<MyMembers name="ConnectionTimeout">\r
+ <exception cref="System.ArgumentException">The value set is less than 0.</exception>\r
+ <remarks>\r
+ A value of 0 indicates no limit, and should be avoided in a \r
+ <a href="ByteFX.Data.MySqlClient.MySqlConnection.ConnectionString.html">ConnectionString</a>\r
+ because an attempt to connect will wait indefinitely.\r
+ </remarks>\r
+ <example>\r
+ The following example creates a MySqlConnection\r
+ and sets some of its properties in the connection string.\r
+ <code lang="Visual Basic"><c>\r
+Public Sub CreateSqlConnection()\r
+ Dim myConnection As New MySqlConnection()\r
+ myConnection.ConnectionString = "Persist Security Info=False;Username=user;Password=pass;database=test1;server=localhost;Connect Timeout=30"\r
+ myConnection.Open()\r
+End Sub\r
+</c></code>\r
+<code lang="C#"><c>\r
+public void CreateSqlConnection() \r
+{\r
+ MySqlConnection myConnection = new MySqlConnection();\r
+ myConnection.ConnectionString = "Persist Security Info=False;Username=user;Password=pass;database=test1;server=localhost;Connect Timeout=30";\r
+ myConnection.Open();\r
+}\r
+</c></code> \r
+ </example>\r
+</MyMembers>\r
+\r
+</MyDocs>
\ No newline at end of file
--- /dev/null
+<MyDocs>\r
+<MyMembers name="Class">\r
+<remarks>\r
+<p>The <A href="frlrfsystemdatasqlclientsqldataadapterclasstopic.htm">MySqlDataAdapter</A> \r
+does not automatically generate the SQL statements required to \r
+reconcile changes made to a <A href="frlrfsystemdatadatasetclasstopic.htm">DataSet</A> with the associated \r
+instance of MySQL. However, you can create a <B>MySqlCommandBuilder</B> \r
+object to automatically generate SQL statements for single-table \r
+updates if you set the <A href="frlrfsystemdatasqlclientsqldataadapterclassselectcommandtopic.htm">SelectCommand</A> \r
+property of the <B>MySqlDataAdapter</B>. Then, any additional SQL \r
+statements that you do not set are generated by the \r
+<B>MySqlCommandBuilder</B>.</p>\r
+<P>The <B>MySqlCommandBuilder</B> registers itself as a listener for <A \r
+href="frlrfsystemdatasqlclientsqldataadapterclassrowupdatingtopic.htm">RowUpdating</A> \r
+events whenever you set the <A \r
+href="frlrfsystemdatasqlclientsqlcommandbuilderclassdataadaptertopic.htm">DataAdapter</A> \r
+property. You can only associate one <B>MySqlDataAdapter</B> or \r
+<B>MySqlCommandBuilder</B> object with each other at one time.</P>\r
+<P>To generate INSERT, UPDATE, or DELETE statements, the \r
+<B>MySqlCommandBuilder</B> uses the <B>SelectCommand</B> property to retrieve a \r
+required set of metadata automatically. If you change the <B>SelectCommand</B> \r
+after the metadata has is retrieved (for example, after the first update), you \r
+should call the <A \r
+href="frlrfsystemdatasqlclientsqlcommandbuilderclassrefreshschematopic.htm">RefreshSchema</A> \r
+method to update the metadata.</P>\r
+<P>The <B>SelectCommand</B> must also return at least one primary key or unique \r
+column. If none are present, an <I>InvalidOperation</I> exception is generated, \r
+and the commands are not generated.</P>\r
+<P>The <B>MySqlCommandBuilder</B> also uses the <A \r
+href="frlrfsystemdatasqlclientsqlcommandclassconnectiontopic.htm">Connection</A>, \r
+<A \r
+href="frlrfsystemdatasqlclientsqlcommandclasscommandtimeouttopic.htm">CommandTimeout</A>, \r
+and <A \r
+href="frlrfsystemdatasqlclientsqlcommandclasstransactiontopic.htm">Transaction</A> \r
+properties referenced by the <B>SelectCommand</B>. The user should call \r
+<B>RefreshSchema</B> if any of these properties are modified, or if the \r
+<B>SelectCommand</B> itself is replaced. Otherwise the <A \r
+href="frlrfsystemdatasqlclientsqldataadapterclassinsertcommandtopic.htm">InsertCommand</A>, \r
+<A \r
+href="frlrfsystemdatasqlclientsqldataadapterclassupdatecommandtopic.htm">UpdateCommand</A>, \r
+and <A \r
+href="frlrfsystemdatasqlclientsqldataadapterclassdeletecommandtopic.htm">DeleteCommand</A> \r
+properties retain their previous values.</P>\r
+<P>If you call <A \r
+href="frlrfsystemcomponentmodelcomponentclassdisposetopic.htm">Dispose</A>, the \r
+<B>MySqlCommandBuilder</B> is disassociated from the <B>MySqlDataAdapter</B>, and \r
+the generated commands are no longer used.</P>\r
+</remarks>\r
+\r
+<example>\r
+ The following example uses the <A \r
+ href="frlrfsystemdatasqlclientsqlcommandclasstopic.htm">MySqlCommand</A>, along <A \r
+ href="frlrfsystemdatasqlclientsqldataadapterclasstopic.htm">MySqlDataAdapter</A> \r
+ and <A \r
+ href="frlrfsystemdatasqlclientsqlconnectionclasstopic.htm">MySqlConnection</A>, to \r
+ select rows from a data source. The example is passed an initialized <A \r
+ href="frlrfsystemdatadatasetclasstopic.htm">DataSet</A>, a connection string, a \r
+ query string that is a SQL SELECT statement, and a string that is the \r
+ name of the database table. The example then creates a <B>MySqlCommandBuilder</B>.\r
+ \r
+ <code lang="Visual Basic">\r
+Public Shared Function SelectRows(myConnection As String, mySelectQuery As String, myTableName As String) As DataSet\r
+ Dim myConn As New MySqlConnection(myConnection)\r
+ Dim myDataAdapter As New MySqlDataAdapter()\r
+ myDataAdapter.SelectCommand = New MySqlCommand(mySelectQuery, myConn)\r
+ Dim cb As SqlCommandBuilder = New MySqlCommandBuilder(myDataAdapter)\r
+\r
+ myConn.Open()\r
+\r
+ Dim ds As DataSet = New DataSet\r
+ myDataAdapter.Fill(ds, myTableName)\r
+\r
+ ' Code to modify data in DataSet here \r
+\r
+ ' Without the MySqlCommandBuilder this line would fail.\r
+ myDataAdapter.Update(ds, myTableName)\r
+\r
+ myConn.Close()\r
+End Function 'SelectRows\r
+ </code>\r
+ <code lang="C#">\r
+public static DataSet SelectRows(string myConnection, string mySelectQuery, string myTableName)\r
+{\r
+ MySqlConnection myConn = new MySqlConnection(myConnection);\r
+ MySqlDataAdapter myDataAdapter = new MySqlDataAdapter();\r
+ myDataAdapter.SelectCommand = new MySqlCommand(mySelectQuery, myConn);\r
+ MySqlCommandBuilder cb = new MySqlCommandBuilder(myDataAdapter);\r
+\r
+ myConn.Open();\r
+\r
+ DataSet ds = new DataSet();\r
+ myDataAdapter.Fill(ds, myTableName);\r
+\r
+ //code to modify data in DataSet here\r
+\r
+ //Without the MySqlCommandBuilder this line would fail\r
+ myDataAdapter.Update(ds, myTableName);\r
+\r
+ myConn.Close();\r
+\r
+ return ds;\r
+}\r
+\r
+ </code>\r
+</example>\r
+\r
+\r
+</MyMembers>\r
+\r
+<MyMembers name="ConnectionTimeout">\r
+ <exception cref="System.ArgumentException">The value set is less than 0.</exception>\r
+ <remarks>\r
+ A value of 0 indicates no limit, and should be avoided in a \r
+ <a href="ByteFX.Data.MySqlClient.MySqlConnection.ConnectionString.html">ConnectionString</a>\r
+ because an attempt to connect will wait indefinitely.\r
+ </remarks>\r
+ <example>\r
+ The following example creates a MySqlConnection\r
+ and sets some of its properties in the connection string.\r
+ <code lang="Visual Basic"><c>\r
+Public Sub CreateSqlConnection()\r
+ Dim myConnection As New MySqlConnection()\r
+ myConnection.ConnectionString = "Persist Security Info=False;Username=user;Password=pass;database=test1;server=localhost;Connect Timeout=30"\r
+ myConnection.Open()\r
+End Sub\r
+</c></code>\r
+<code lang="C#"><c>\r
+public void CreateSqlConnection() \r
+{\r
+ MySqlConnection myConnection = new MySqlConnection();\r
+ myConnection.ConnectionString = "Persist Security Info=False;Username=user;Password=pass;database=test1;server=localhost;Connect Timeout=30";\r
+ myConnection.Open();\r
+}\r
+</c></code> \r
+ </example>\r
+</MyMembers>\r
+\r
+</MyDocs>
\ No newline at end of file
--- /dev/null
+<MyDocs>\r
+<MyMembers name="Class">\r
+<remarks>\r
+ <para>\r
+ A <b>MySqlConnection</b> object represents a session to a MySQL Server \r
+ data source. When you create an instance of <B>MySqlConnection</B>, all \r
+ properties are set to their initial values. For a list of these values, see the \r
+ <B>MySqlConnection</B> constructor.\r
+ </para>\r
+\r
+ <para>\r
+ If the <B>MySqlConnection</B> goes out of scope, it is not closed. Therefore, \r
+ you must explicitly close the connection by calling <see cref="MySqlConnection.Close"/> \r
+ or <see cref="MySqlConnection.Dispose"/>.\r
+ </para>\r
+\r
+</remarks>\r
+\r
+<example>\r
+ The following example creates a <see cref="MySqlCommand"/> and \r
+ a <B>MySqlConnection</B>. The <B>MySqlConnection</B> is opened and set as the \r
+ <see cref="MySqlCommand.Connection"/> for the <B>MySqlCommand</B>. The example then calls \r
+ <see cref="MySqlCommand.ExecuteNonQuery"/>, and closes the connection. To accomplish this, the <B>ExecuteNonQuery</B> is \r
+ passed a connection string and a query string that is a SQL INSERT \r
+ statement.\r
+ <code lang="Visual Basic">\r
+ <c>\r
+Public Sub InsertRow(myConnectionString As String)\r
+ ' If the connection string is null, use a default.\r
+ If myConnectionString = "" Then\r
+ myConnectionString = "Database=Test;Data Source=localhost;User Id=username;Password=pass"\r
+ End If\r
+ Dim myConnection As New MySqlConnection(myConnectionString)\r
+ Dim myInsertQuery As String = "INSERT INTO Orders (id, customerId, amount) Values(1001, 23, 30.66)"\r
+ Dim myCommand As New MySqlCommand(myInsertQuery)\r
+ myCommand.Connection = myConnection\r
+ myConnection.Open()\r
+ myCommand.ExecuteNonQuery()\r
+ myCommand.Connection.Close()\r
+End Sub\r
+</c> \r
+ </code>\r
+ <code lang="C#">\r
+<c>\r
+public void InsertRow(string myConnectionString) \r
+{\r
+ // If the connection string is null, use a default.\r
+ if(myConnectionString == "") \r
+ {\r
+ myConnectionString = "Database=Test;Data Source=localhost;User Id=username;Password=pass";\r
+ }\r
+ MySqlConnection myConnection = new MySqlConnection(myConnectionString);\r
+ string myInsertQuery = "INSERT INTO Orders (id, customerId, amount) Values(1001, 23, 30.66)";\r
+ MySqlCommand myCommand = new MySqlCommand(myInsertQuery);\r
+ myCommand.Connection = myConnection;\r
+ myConnection.Open();\r
+ myCommand.ExecuteNonQuery();\r
+ myCommand.Connection.Close();\r
+}\r
+</c>\r
+ </code>\r
+</example>\r
+\r
+\r
+</MyMembers>\r
+\r
+<MyMembers name="ConnectionTimeout">\r
+ <exception cref="System.ArgumentException">The value set is less than 0.</exception>\r
+ <remarks>\r
+ A value of 0 indicates no limit, and should be avoided in a \r
+ <see cref="MySqlConnection.ConnectionString"/> because an attempt to connect \r
+ will wait indefinitely.\r
+ </remarks>\r
+ <example>\r
+ The following example creates a MySqlConnection\r
+ and sets some of its properties in the connection string.\r
+ <code lang="Visual Basic">\r
+Public Sub CreateSqlConnection()\r
+ Dim myConnection As New MySqlConnection()\r
+ myConnection.ConnectionString = "Persist Security Info=False;Username=user;Password=pass;database=test1;server=localhost;Connect Timeout=30"\r
+ myConnection.Open()\r
+End Sub\r
+</code>\r
+<code lang="C#">\r
+public void CreateSqlConnection() \r
+{\r
+ MySqlConnection myConnection = new MySqlConnection();\r
+ myConnection.ConnectionString = "Persist Security Info=False;Username=user;Password=pass;database=test1;server=localhost;Connect Timeout=30";\r
+ myConnection.Open();\r
+}\r
+</code> \r
+ </example>\r
+</MyMembers>\r
+\r
+\r
+<MyMembers name="ConnectionString">\r
+ <remarks>\r
+ <para>The <B>ConnectionString</B> returned may not be exactly like what was originally\r
+ set but will be indentical in terms of keyword/value pairs. Security information\r
+ will not be included unless the Persist Security Info value is set to true. \r
+ </para>\r
+ <para>You can use the <B>ConnectionString</B> property to connect to a database. \r
+ The following example illustrates a typical connection string.</para>\r
+ <c>"Persist Security Info=False;database=MyDB;server=MySqlServer;user id=myUser;Password=myPass"</c>\r
+ <para>The <B>ConnectionString</B> property can be set only when the connection is \r
+ closed. Many of the connection string values have corresponding read-only \r
+ properties. When the connection string is set, all of these properties are \r
+ updated, except when an error is detected. In this case, none of the properties \r
+ are updated. <see cref="MySqlConnection"/> properties return only those settings contained in the \r
+ <B>ConnectionString</B>.</para>\r
+ <para>To connect to a local machine, specify "localhost" for the server. If you do not \r
+ specify a server, localhost is assumed.</para>\r
+ <para>Resetting the <B>ConnectionString</B> on a closed connection resets all \r
+ connection string values (and related properties) including the password. For \r
+ example, if you set a connection string that includes "Database= MyDb", and \r
+ then reset the connection string to "Data Source=myserver;User Id=myUser;Password=myPass", \r
+ the <see cref="MySqlConnection.Database"/> property is no longer set to MyDb.</para>\r
+ <para>The connection string is parsed immediately after being set. If errors in \r
+ syntax are found when parsing, a runtime exception, such as <see cref="ArgumentException"/>, \r
+ is generated. Other errors can be found only when an attempt is made to open the \r
+ connection.</para>\r
+ <para>The basic format of a connection string consists of a series of keyword/value \r
+ pairs separated by semicolons. The equal sign (=) connects each keyword and its \r
+ value. To include values that contain a semicolon, single-quote character, or \r
+ double-quote character, the value must be enclosed in double quotes. If the \r
+ value contains both a semicolon and a double-quote character, the value can be \r
+ enclosed in single quotes. The single quote is also useful if the value begins \r
+ with a double-quote character. Conversely, the double quote can be used if the \r
+ value begins with a single quote. If the value contains both single-quote and \r
+ double-quote characters, the quote character used to enclose the value must be \r
+ doubled each time it occurs within the value.</para>\r
+ <para>To include preceding or trailing spaces in the string value, the value must \r
+ be enclosed in either single quotes or double quotes. Any leading or trailing \r
+ spaces around integer, Boolean, or enumerated values are ignored, even if \r
+ enclosed in quotes. However, spaces within a string literal keyword or value are \r
+ preserved. Using .NET Framework version 1.1, single or double quotes may be used \r
+ within a connection string without using delimiters (for example, Data Source= \r
+ my'Server or Data Source= my"Server), unless a quote character is the first or \r
+ last character in the value.</para>\r
+ <para>To include an equal sign (=) in a keyword or value, it must be preceded by \r
+ another equal sign. For example, in the hypothetical connection string</para>\r
+ <c>"key==word=value"</c>\r
+ <para></para>\r
+ <para>the keyword is "key=word" and the value is "value".</para>\r
+ <para>If a specific keyword in a keyword= value pair occurs multiple times in a \r
+ connection string, the last occurrence listed is used in the value set.</para>\r
+ <para>Keywords are not case sensitive.</para>\r
+ <para>The following table lists the valid names for keyword values within the \r
+ <B>ConnectionString</B>.</para>\r
+ <div class="tablediv"><table class="dtTABLE" cellspacing="0"><tr valign="top">\r
+ <th width="33%">Name</th>\r
+ <th width="33%">Default</th>\r
+ <th width="33%">Description</th>\r
+ </tr>\r
+ <tr>\r
+ <td>Connect Timeout<para> -or- </para>Connection Timeout</td>\r
+ <td>15</td>\r
+ <td>The length of time (in seconds) to wait for a connection to the server before \r
+terminating the attempt and generating an error.</td>\r
+ </tr>\r
+ <tr>\r
+ <td>\r
+ Host<para> -or- </para>Server<para> -or- </para>Data Source<para> -or- </para>\r
+ DataSource<para> -or- </para>Address<para> -or- </para>Addr<para> -or- </para>\r
+ Network Address\r
+ </td>\r
+ <td>localhost</td>\r
+ <td><para>The name or network address of the instance of MySQL to which to connect. Multiple hosts can be\r
+ specified separated by &. This can be useful where multiple MySQL servers are configured for replication\r
+ and you are not concerned about the precise server you are connecting to. No attempt is made by the provider to\r
+ synchronize writes to the database so care should be taken when using this option.\r
+ </para>\r
+ <para>\r
+ In Unix environment with Mono, this can be a fully qualified path to MySQL socket filename. With this configuration, the Unix socket will be used instead of TCP/IP socket.\r
+ Currently only a single socket name can be given so accessing MySQL in a replicated environment using Unix sockets is not currently supported.\r
+ </para>\r
+ </td>\r
+ </tr>\r
+ <tr>\r
+ <td>Port</td>\r
+ <td>3306</td>\r
+ <td>The port MySQL is using to listen for connections. Specify -1 for this value to use a \r
+ named pipe connection (Windows only). This value is ignored if Unix socket is used.</td>\r
+ </tr>\r
+ <tr>\r
+ <td>Encrypt</td>\r
+ <td>false</td>\r
+ <td>When <B>true</B>, SSL encryption is used for all data sent between the \r
+client and server if the server has a certificate installed. Recognized values \r
+are <B>true</B>, <B>false</B>, <B>yes</B>, and <B>no</B>.<para><b>Note</b> This parameter currently has no\r
+effect.</para></td>\r
+ </tr>\r
+ <tr>\r
+ <td>Initial Catalog<para> -or- </para>Database</td>\r
+ <td></td>\r
+ <td>The name of the database to use intially</td>\r
+ </tr>\r
+ <tr>\r
+ <td>Password<para> -or- </para>pwd</td>\r
+ <td></td>\r
+ <td>The password for the MySQL account being used.</td>\r
+ </tr>\r
+ <tr>\r
+ <td>Persist Security Info</td>\r
+ <td>false</td>\r
+ <td>When set to <B>false</B> or <B>no</B> (strongly recommended), security-sensitive \r
+information, such as the password, is not returned as part of the connection if \r
+the connection is open or has ever been in an open state. Resetting the \r
+connection string resets all connection string values including the password. \r
+Recognized values are <B>true</B>, <B>false</B>, <B>yes</B>, and <B>no</B>.</td>\r
+ </tr>\r
+ <tr>\r
+ <td>User Id<para> -or- </para>Username<para> -or- </para>Uid<para> -or- </para>User name</td>\r
+ <td></td>\r
+ <td>The MySQL login account being used.</td>\r
+ </tr>\r
+ </table>\r
+ </div>\r
+ <para>\r
+ The following table lists the valid names for connection pooling values within \r
+the <B>ConnectionString</B>. For more information about connection pooling, see \r
+Connection Pooling for the ByteFX Data Provider for MySQL.</para>\r
+ <div class="tablediv"><table class="dtTABLE" cellspacing="0"><tr valign="top">\r
+ <th width="33%">Name</th>\r
+ <th width="33%">Default</th>\r
+ <th width="33%">Description</th>\r
+ </tr>\r
+ <tr>\r
+ <td>Connection Lifetime</td>\r
+ <td>0</td>\r
+ <td>When a connection is returned to the pool, its creation time is compared with \r
+the current time, and the connection is destroyed if that time span (in seconds) \r
+exceeds the value specified by <B>Connection Lifetime</B>. This is useful in \r
+clustered configurations to force load balancing between a running server and a \r
+server just brought online. \r
+<para>A value of zero (0) causes pooled connections to have the maximum connection \r
+timeout.</para></td>\r
+ </tr>\r
+ <tr>\r
+ <td>Max Pool Size</td>\r
+ <td>100</td>\r
+ <td>The maximum number of connections allowed in the pool.</td>\r
+ </tr>\r
+ <tr>\r
+ <td>Min Pool Size</td>\r
+ <td>0</td>\r
+ <td>The minimum number of connections allowed in the pool.</td>\r
+ </tr>\r
+ <tr>\r
+ <td>Pooling</td>\r
+ <td>true</td>\r
+ <td>When <B>true</B>, the <B>MySqlConnection</B> object is drawn from the appropriate \r
+pool, or if necessary, is created and added to the appropriate pool. Recognized \r
+values are <B>true</B>, <B>false</B>, <B>yes</B>, and <B>no</B>.</td>\r
+ </tr>\r
+ <tr>\r
+ <td>Use Pipe<para> -or- </para>Pipe</td>\r
+ <td></td>\r
+ <td>When set to the name of a named pipe, the <B>MySqlConnection</B> will attempt to connect to MySQL\r
+ on that named pipe.<br/><br/>This settings only applies to the Windows platform.</td>\r
+ </tr>\r
+ </table></div>\r
+<para>When setting keyword or connection pooling values that require a Boolean \r
+value, you can use 'yes' instead of 'true', and 'no' instead of 'false'.</para>\r
+<para><B>Note</B> The ByteFX Data Provider for MySQL uses the native socket protocol to \r
+communicate with MySQL. Therefore, it does not support the use of an ODBC data source name (DSN) when \r
+connecting to MySQL because it does not add an ODBC layer.</para>\r
+<para><B>CAUTION</B> In this release, the application should use caution when constructing a \r
+connection string based on user input (for example when retrieving user ID and password information from a \r
+dialog box, and appending it to the connection string). The application should \r
+ensure that a user cannot embed extra connection string parameters in these \r
+values (for example, entering a password as "validpassword;database=somedb" in \r
+an attempt to attach to a different database).</para>\r
+ </remarks>\r
+ <example>\r
+ The following example creates a <see cref="MySqlConnection"/> and sets some of its properties\r
+ <code lang="Visual Basic">\r
+ Public Sub CreateConnection()\r
+ Dim myConnection As New MySqlConnection()\r
+ myConnection.ConnectionString = "Persist Security Info=False;database=myDB;server=myHost;Connect Timeout=30;user id=myUser; pwd=myPass"\r
+ myConnection.Open()\r
+ End Sub 'CreateConnection\r
+ </code>\r
+ <code lang="C#">\r
+ public void CreateConnection() \r
+ {\r
+ MySqlConnection myConnection = new MySqlConnection();\r
+ myConnection.ConnectionString = "Persist Security Info=False;database=myDB;server=myHost;Connect Timeout=30;user id=myUser; pwd=myPass";\r
+ myConnection.Open();\r
+ }\r
+ </code>\r
+</example>\r
+ <example>\r
+ The following example creates a <see cref="MySqlConnection"/> in Unix environment with Mono installed. MySQL socket filename used in this example is "/var/lib/mysql/mysql.sock". The actual filename depends on your MySQL configuration.\r
+ <code lang="Visual Basic">\r
+ Public Sub CreateConnection()\r
+ Dim myConnection As New MySqlConnection()\r
+ myConnection.ConnectionString = "database=myDB;server=/var/lib/mysql/mysql.sock;user id=myUser; pwd=myPass"\r
+ myConnection.Open()\r
+ End Sub 'CreateConnection\r
+ </code>\r
+ <code lang="C#">\r
+ public void CreateConnection() \r
+ {\r
+ MySqlConnection myConnection = new MySqlConnection();\r
+ myConnection.ConnectionString = "database=myDB;server=/var/lib/mysql/mysql.sock;user id=myUser; pwd=myPass";\r
+ myConnection.Open();\r
+ }\r
+ </code>\r
+ </example>\r
+</MyMembers>\r
+</MyDocs>\r
--- /dev/null
+<MyDocs>\r
+<MyMembers name="Class">\r
+<remarks>\r
+ <para>\r
+ The <B>MySQLDataAdapter</B>, serves as a bridge between a <see cref="System.Data.DataSet"/>\r
+ and MySQL for retrieving and saving data. The <B>MySQLDataAdapter</B> provides this \r
+ bridge by mapping <see cref="DbDataAdapter.Fill"/>, which changes the data in the \r
+ <B>DataSet</B> to match the data in the data source, and <see cref="DbDataAdapter.Update"/>, \r
+ which changes the data in the data source to match the data in the <B>DataSet</B>, \r
+ using the appropriate SQL statements against the data source.\r
+ </para>\r
+ <para>\r
+ When the <B>MySQLDataAdapter</B> fills a <B>DataSet</B>, it will create the necessary \r
+ tables and columns for the returned data if they do not already exist. However, primary \r
+ key information will not be included in the implicitly created schema unless the \r
+ <see cref="System.Data.MissingSchemaAction"/> property is set to <see cref="System.Data.MissingSchemaAction.AddWithKey"/>. \r
+ You may also have the <B>MySQLDataAdapter</B> create the schema of the <B>DataSet</B>, \r
+ including primary key information, before filling it with data using <see cref="System.Data.Common.DbDataAdapter.FillSchema"/>. \r
+ </para>\r
+ <para><B>MySQLDataAdapter</B> is used in conjunction with <see cref="MySqlConnection"/>\r
+ and <see cref="MySqlCommand"/> to increase performance when connecting to a MySQL database.\r
+ </para>\r
+ <para>The <B>MySQLDataAdapter</B> also includes the <see cref="MySqlDataAdapter.SelectCommand"/>, \r
+ <see cref="MySqlDataAdapter.InsertCommand"/>, <see cref="MySqlDataAdapter.DeleteCommand"/>, \r
+ <see cref="MySqlDataAdapter.UpdateCommand"/>, and <see cref="DataAdapter.TableMappings"/> \r
+ properties to facilitate the loading and updating of data.\r
+ </para>\r
+ <para>When an instance of <B>MySQLDataAdapter</B> is created, the read/write properties \r
+ are set to initial values. For a list of these values, see the <B>MySQLDataAdapter</B> \r
+ constructor.\r
+ </para>\r
+</remarks>\r
+\r
+<example>\r
+ The following example creates a <see cref="MySqlCommand"/> and a <see cref="MySqlConnection"/>. \r
+ The <B>MySqlConnection</B> is opened and set as the <see cref="MySqlCommand.Connection"/> for the \r
+ <B>MySqlCommand</B>. The example then calls <see cref="MySqlCommand.ExecuteNonQuery"/>, and closes \r
+ the connection. To accomplish this, the <B>ExecuteNonQuery</B> is \r
+ passed a connection string and a query string that is a SQL INSERT \r
+ statement.\r
+ <code lang="Visual Basic">\r
+Public Function SelectRows(dataSet As DataSet, connection As String, query As String) As DataSet\r
+ Dim conn As New MySqlConnection(connection)\r
+ Dim adapter As New MySqlDataAdapter()\r
+ adapter.SelectCommand = new MySqlCommand(query, conn)\r
+ adapter.Fill(dataset)\r
+ Return dataset\r
+End Function\r
+ </code>\r
+ <code lang="C#">\r
+public DataSet SelectRows(DataSet dataset,string connection,string query) \r
+{\r
+ MySqlConnection conn = new MySqlConnection(connection);\r
+ MySqlDataAdapter adapter = new MySqlDataAdapter();\r
+ adapter.SelectCommand = new MySqlCommand(query, conn);\r
+ adapter.Fill(dataset);\r
+ return dataset;\r
+}\r
+ </code>\r
+</example>\r
+</MyMembers>\r
+\r
+<MyMembers name="ConnectionTimeout">\r
+ <exception cref="System.ArgumentException">The value set is less than 0.</exception>\r
+ <remarks>\r
+ A value of 0 indicates no limit, and should be avoided in a <see cref="MySqlConnection.ConnectionString"/> \r
+ because an attempt to connect will wait indefinitely.\r
+ </remarks>\r
+ <example>\r
+ The following example creates a MySqlConnection\r
+ and sets some of its properties in the connection string.\r
+ <code lang="Visual Basic"><c>\r
+Public Sub CreateSqlConnection()\r
+ Dim myConnection As New MySqlConnection()\r
+ myConnection.ConnectionString = "Persist Security Info=False;Username=user;Password=pass;database=test1;server=localhost;Connect Timeout=30"\r
+ myConnection.Open()\r
+End Sub\r
+</c></code>\r
+<code lang="C#"><c>\r
+public void CreateSqlConnection() \r
+{\r
+ MySqlConnection myConnection = new MySqlConnection();\r
+ myConnection.ConnectionString = "Persist Security Info=False;Username=user;Password=pass;database=test1;server=localhost;Connect Timeout=30";\r
+ myConnection.Open();\r
+}\r
+</c></code> \r
+ </example>\r
+</MyMembers>\r
+\r
+</MyDocs>
\ No newline at end of file
--- /dev/null
+<MyDocs>\r
+<MyMembers name="Class">\r
+<remarks>\r
+ <para>To create a <B>MySQLDataReader</B>, you must call the <see cref="MySqlCommand.ExecuteReader"/>\r
+ method of the <see cref="MySqlCommand"/> object, rather than directly using a constructor.\r
+ </para>\r
+ <para>While the <B>MySqlDataReader</B> is in use, the associated <see cref="MySqlConnection"/>\r
+ is busy serving the <B>MySqlDataReader</B>, and no other operations can be performed \r
+ on the <B>MySqlConnection</B> other than closing it. This is the case until the \r
+ <see cref="MySqlDataReader.Close"/> method of the <B>MySqlDataReader</B> is called. \r
+ </para>\r
+ <para>Changes made to a resultset by another process or thread while data is being \r
+ read may be visible to the user of the <B>MySqlDataReader</B>. However, the \r
+ precise behavior is timing dependent.\r
+ </para>\r
+ <para><see cref="MySqlDataReader.IsClosed"/> and <see cref="MySqlDataReader.RecordsAffected"/> \r
+ are the only properties that you can call after the <B>MySqlDataReader</B> is \r
+ closed. Though the <B>RecordsAffected</B> property may be accessed at any time \r
+ while the <B>MySqlDataReader</B> exists, always call <B>Close</B> before returning \r
+ the value of <B>RecordsAffected</B> to ensure an accurate return value.\r
+ </para>\r
+ <para>For optimal performance, <B>MySqlDataReader</B> avoids creating \r
+ unnecessary objects or making unnecessary copies of data. As a result, multiple calls \r
+ to methods such as <see cref="MySqlDataReader.GetValue"/> return a reference to the \r
+ same object. Use caution if you are modifying the underlying value of the objects \r
+ returned by methods such as <B>GetValue</B>.\r
+ </para>\r
+</remarks>\r
+\r
+<example>\r
+ The following example creates a <see cref="MySqlConnection"/>, \r
+ a <see cref="MySqlCommand"/>, and a <B>MySqlDataReader</B>. The example reads through \r
+ the data, writing it out to the console. Finally, the example closes the <B>MySqlDataReader</B>, then the \r
+ <B>MySqlConnection</B>.\r
+ <code lang="Visual Basic">\r
+Public Sub ReadMyData(myConnString As String)\r
+ Dim mySelectQuery As String = "SELECT OrderID, CustomerID FROM Orders"\r
+ Dim myConnection As New MySqlConnection(myConnString)\r
+ Dim myCommand As New MySqlCommand(mySelectQuery, myConnection)\r
+ myConnection.Open()\r
+ Dim myReader As MySqlDataReader\r
+ myReader = myCommand.ExecuteReader()\r
+ ' Always call Read before accessing data.\r
+ While myReader.Read()\r
+ Console.WriteLine((myReader.GetInt32(0) & ", " & myReader.GetString(1)))\r
+ End While\r
+ ' always call Close when done reading.\r
+ myReader.Close()\r
+ ' Close the connection when done with it.\r
+ myConnection.Close()\r
+End Sub 'ReadMyData\r
+ </code>\r
+ <code lang="C#">\r
+public void ReadMyData(string myConnString) {\r
+ string mySelectQuery = "SELECT OrderID, CustomerID FROM Orders";\r
+ MySqlConnection myConnection = new MySqlConnection(myConnString);\r
+ MySqlCommand myCommand = new MySqlCommand(mySelectQuery,myConnection);\r
+ myConnection.Open();\r
+ MySqlDataReader myReader;\r
+ myReader = myCommand.ExecuteReader();\r
+ // Always call Read before accessing data.\r
+ while (myReader.Read()) {\r
+ Console.WriteLine(myReader.GetInt32(0) + ", " + myReader.GetString(1));\r
+ }\r
+ // always call Close when done reading.\r
+ myReader.Close();\r
+ // Close the connection when done with it.\r
+ myConnection.Close();\r
+ }\r
+ </code>\r
+</example>\r
+\r
+\r
+</MyMembers>\r
+\r
+\r
+\r
+</MyDocs>
\ No newline at end of file
--- /dev/null
+<MyDocs>\r
+<MyMembers name="Class">\r
+<remarks>\r
+ <para>\r
+ This class is created whenever the ByteFX Data Provider for MySQL \r
+ encounters an error generated from the server.\r
+ </para>\r
+ <para>\r
+ Any open connections are not automatically closed when an exception is thrown. If \r
+ the client application determines that the exception is fatal, it should close any open\r
+ <see cref="MySqlDataReader"/> objects or <see cref="MySqlConnection"/> objects.\r
+ </para>\r
+</remarks>\r
+\r
+<example>\r
+ The following example generates a <B>MySqlException</B> due to a missing server, \r
+ and then displays the exception.\r
+ \r
+ <code lang="Visual Basic">\r
+Public Sub ShowException()\r
+ Dim mySelectQuery As String = "SELECT column1 FROM table1"\r
+ Dim myConnection As New MySqlConnection ("Data Source=localhost;Database=Sample;")\r
+ Dim myCommand As New MySqlCommand(mySelectQuery, myConnection)\r
+\r
+ Try\r
+ myCommand.Connection.Open()\r
+ Catch e As MySqlException\r
+ MessageBox.Show( e.Message )\r
+ End Try\r
+ End Sub\r
+ </code>\r
+ <code lang="C#">\r
+public void ShowException() \r
+{\r
+ string mySelectQuery = "SELECT column1 FROM table1";\r
+ MySqlConnection myConnection =\r
+ new MySqlConnection("Data Source=localhost;Database=Sample;");\r
+ MySqlCommand myCommand = new MySqlCommand(mySelectQuery,myConnection);\r
+\r
+ try \r
+ {\r
+ myCommand.Connection.Open();\r
+ }\r
+ catch (MySqlException e) \r
+ {\r
+ MessageBox.Show( e.Message );\r
+ }\r
+}\r
+ </code>\r
+</example>\r
+\r
+\r
+</MyMembers>\r
+</MyDocs>
\ No newline at end of file
--- /dev/null
+<MyDocs>\r
+<MyMembers name="Class">\r
+<remarks>\r
+ <para>\r
+ This class is created whenever the ByteFX Data Provider for MySQL \r
+ encounters an error generated from the server.\r
+ </para>\r
+ <para>\r
+ Any open connections are not automatically closed when an exception is thrown. If \r
+ the client application determines that the exception is fatal, it should close any open\r
+ <see cref="MySqlDataReader"/> objects or <see cref="MySqlConnection"/> objects.\r
+ </para>\r
+</remarks>\r
+\r
+<example>\r
+ The following example generates a <B>MySqlException</B> due to a missing server, \r
+ and then displays the exception.\r
+ \r
+ <code lang="Visual Basic">\r
+Public Sub ShowException()\r
+ Dim mySelectQuery As String = "SELECT column1 FROM table1"\r
+ Dim myConnection As New MySqlConnection ("Data Source=localhost;Database=Sample;")\r
+ Dim myCommand As New MySqlCommand(mySelectQuery, myConnection)\r
+\r
+ Try\r
+ myCommand.Connection.Open()\r
+ Catch e As MySqlException\r
+ MessageBox.Show( e.Message )\r
+ End Try\r
+ End Sub\r
+ </code>\r
+ <code lang="C#">\r
+public void ShowException() \r
+{\r
+ string mySelectQuery = "SELECT column1 FROM table1";\r
+ MySqlConnection myConnection =\r
+ new MySqlConnection("Data Source=localhost;Database=Sample;");\r
+ MySqlCommand myCommand = new MySqlCommand(mySelectQuery,myConnection);\r
+\r
+ try \r
+ {\r
+ myCommand.Connection.Open();\r
+ }\r
+ catch (MySqlException e) \r
+ {\r
+ MessageBox.Show( e.Message );\r
+ }\r
+}\r
+ </code>\r
+</example>\r
+\r
+\r
+</MyMembers>\r
+</MyDocs>
\ No newline at end of file
--- /dev/null
+<MyDocs>\r
+<MyMembers name="Class">\r
+<remarks>\r
+ Parameter names are not case sensitive.\r
+</remarks>\r
+\r
+<example>\r
+ The following example creates multiple instances of <B>MySqlParameter</B> through the \r
+ <see cref="MySqlParameterCollection"/> collection within the <see cref="MySqlDataAdapter"/>. \r
+ These parameters are used to select data from the data source and place the data \r
+ in the <see cref="DataSet"/>. This example assumes that a <B>DataSet</B> and a \r
+ <B>MySqlDataAdapter</B> have already been created with the appropriate schema, commands, \r
+ and connection.\r
+<code lang="Visual Basic">\r
+Public Sub AddSqlParameters()\r
+ ' ...\r
+ ' create myDataSet and myDataAdapter\r
+ ' ...\r
+ myDataAdapter.SelectCommand.Parameters.Add("@CategoryName", MySqlDbType.VarChar, 80).Value = "toasters"\r
+ myDataAdapter.SelectCommand.Parameters.Add("@SerialNum", MySqlDbType.Long).Value = 239\r
+ \r
+ myDataAdapter.Fill(myDataSet)\r
+End Sub 'AddSqlParameters \r
+ </code>\r
+ <code lang="C#">\r
+public void AddSqlParameters() \r
+{\r
+// ...\r
+// create myDataSet and myDataAdapter\r
+// ...\r
+\r
+ myDataAdapter.SelectCommand.Parameters.Add("@CategoryName", MySqlDbType.VarChar, 80).Value = "toasters";\r
+ myDataAdapter.SelectCommand.Parameters.Add("@SerialNum", MySqlDbType.Long).Value = 239;\r
+ myDataAdapter.Fill(myDataSet);\r
+\r
+}\r
+ </code>\r
+</example>\r
+\r
+\r
+</MyMembers>\r
+\r
+\r
+\r
+</MyDocs>
\ No newline at end of file
--- /dev/null
+<MyDocs>\r
+<MyMembers name="Class">\r
+<remarks>\r
+ The number of the parameters in the collection must be equal to the number of \r
+parameter placeholders within the command text, or an exception will be generated.\r
+</remarks>\r
+\r
+<example>\r
+ The following example creates multiple instances of <see cref="MySqlParameter"/> \r
+ through the <B>MySqlParameterCollection</B> collection within the <see cref="MySqlDataAdapter"/>. \r
+ These parameters are used to select data within the data source and place the data in \r
+ the <see cref="DataSet"/>. This code assumes that a <B>DataSet</B> and a <B>MySqlDataAdapter</B> \r
+ have already been created with the appropriate schema, commands, and connection.\r
+<code lang="Visual Basic">\r
+Public Sub AddParameters()\r
+ ' ...\r
+ ' create myDataSet and myDataAdapter\r
+ ' ...\r
+ myDataAdapter.SelectCommand.Parameters.Add("@CategoryName", MySqlDbType.VarChar, 80).Value = "toasters"\r
+ myDataAdapter.SelectCommand.Parameters.Add("@SerialNum", MySqlDbType.Long).Value = 239\r
+ \r
+ myDataAdapter.Fill(myDataSet)\r
+End Sub 'AddSqlParameters \r
+ </code>\r
+ <code lang="C#">\r
+public void AddSqlParameters() \r
+{\r
+// ...\r
+// create myDataSet and myDataAdapter\r
+// ...\r
+\r
+ myDataAdapter.SelectCommand.Parameters.Add("@CategoryName", MySqlDbType.VarChar, 80).Value = "toasters";\r
+ myDataAdapter.SelectCommand.Parameters.Add("@SerialNum", MySqlDbType.Long).Value = 239;\r
+ myDataAdapter.Fill(myDataSet);\r
+\r
+}\r
+ </code>\r
+</example>\r
+\r
+\r
+</MyMembers>\r
+\r
+\r
+\r
+</MyDocs>
\ No newline at end of file
--- /dev/null
+<MyDocs>\r
+<MyMembers name="Class">\r
+<remarks>\r
+ The application creates a <B>MySqlTransaction</B> object by calling <see cref="MySqlConnection.BeginTransaction"/>\r
+ on the <see cref="MySqlConnection"/> object. All subsequent operations associated with the \r
+ transaction (for example, committing or aborting the transaction), are performed on the \r
+ <B>MySqlTransaction</B> object.\r
+</remarks>\r
+\r
+<example>\r
+ The following example creates a <see cref="MySqlConnection"/> and a <B>MySqlTransaction</B>. \r
+ It also demonstrates how to use the <see cref="MySqlConnection.BeginTransaction"/>, \r
+ <see cref="MySqlTransaction.Commit"/>, and <see cref="MySqlTransaction.Rollback"/> methods.\r
+ <code lang="Visual Basic">\r
+Public Sub RunTransaction(myConnString As String)\r
+ Dim myConnection As New MySqlConnection(myConnString)\r
+ myConnection.Open()\r
+ \r
+ Dim myCommand As MySqlCommand = myConnection.CreateCommand()\r
+ Dim myTrans As MySqlTransaction\r
+ \r
+ ' Start a local transaction\r
+ myTrans = myConnection.BeginTransaction()\r
+ ' Must assign both transaction object and connection\r
+ ' to Command object for a pending local transaction\r
+ myCommand.Connection = myConnection\r
+ myCommand.Transaction = myTrans\r
+ \r
+ Try\r
+ myCommand.CommandText = "Insert into Region (RegionID, RegionDescription) VALUES (100, 'Description')"\r
+ myCommand.ExecuteNonQuery()\r
+ myCommand.CommandText = "Insert into Region (RegionID, RegionDescription) VALUES (101, 'Description')"\r
+ myCommand.ExecuteNonQuery()\r
+ myTrans.Commit()\r
+ Console.WriteLine("Both records are written to database.")\r
+ Catch e As Exception\r
+ Try\r
+ myTrans.Rollback()\r
+ Catch ex As MySqlException\r
+ If Not myTrans.Connection Is Nothing Then\r
+ Console.WriteLine("An exception of type " & ex.GetType().ToString() & _\r
+ " was encountered while attempting to roll back the transaction.")\r
+ End If\r
+ End Try\r
+ \r
+ Console.WriteLine("An exception of type " & e.GetType().ToString() & _\r
+ "was encountered while inserting the data.")\r
+ Console.WriteLine("Neither record was written to database.")\r
+ Finally\r
+ myConnection.Close()\r
+ End Try\r
+End Sub 'RunTransaction\r
+ </code>\r
+ <code lang="C#">\r
+public void RunTransaction(string myConnString) \r
+ {\r
+ MySqlConnection myConnection = new MySqlConnection(myConnString);\r
+ myConnection.Open();\r
+\r
+ MySqlCommand myCommand = myConnection.CreateCommand();\r
+ MySqlTransaction myTrans;\r
+\r
+ // Start a local transaction\r
+ myTrans = myConnection.BeginTransaction();\r
+ // Must assign both transaction object and connection\r
+ // to Command object for a pending local transaction\r
+ myCommand.Connection = myConnection;\r
+ myCommand.Transaction = myTrans;\r
+\r
+ try\r
+ {\r
+ myCommand.CommandText = "Insert into Region (RegionID, RegionDescription) VALUES (100, 'Description')";\r
+ myCommand.ExecuteNonQuery();\r
+ myCommand.CommandText = "Insert into Region (RegionID, RegionDescription) VALUES (101, 'Description')";\r
+ myCommand.ExecuteNonQuery();\r
+ myTrans.Commit();\r
+ Console.WriteLine("Both records are written to database.");\r
+ }\r
+ catch(Exception e)\r
+ {\r
+ try\r
+ {\r
+ myTrans.Rollback();\r
+ }\r
+ catch (MySqlException ex)\r
+ {\r
+ if (myTrans.Connection != null)\r
+ {\r
+ Console.WriteLine("An exception of type " + ex.GetType() +\r
+ " was encountered while attempting to roll back the transaction.");\r
+ }\r
+ }\r
+ \r
+ Console.WriteLine("An exception of type " + e.GetType() +\r
+ " was encountered while inserting the data.");\r
+ Console.WriteLine("Neither record was written to database.");\r
+ }\r
+ finally \r
+ {\r
+ myConnection.Close();\r
+ }\r
+}\r
+ </code>\r
+</example>\r
+\r
+\r
+</MyMembers>\r
+\r
+\r
+\r
+</MyDocs>
\ No newline at end of file
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Data;
-using System.Text;
-using System.ComponentModel;
-using System.ComponentModel.Design.Serialization;
-using System.Reflection;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Represents a parameter to a <see cref="MySqlCommand"/>, and optionally, its mapping to <see cref="DataSet"/> columns. This class cannot be inherited.
- /// </summary>
- [TypeConverter(typeof(MySqlParameter.MySqlParameterConverter))]
- public sealed class MySqlParameter : MarshalByRefObject, IDataParameter, IDbDataParameter, ICloneable
- {
- private MySqlDbType dbType = MySqlDbType.Null;
- private DbType genericType;
- private ParameterDirection direction = ParameterDirection.Input;
- private bool isNullable = false;
- private string paramName;
- private string sourceColumn;
- private DataRowVersion sourceVersion = DataRowVersion.Current;
- private object paramValue = DBNull.Value;
- private int size;
- private byte precision=0, scale=0;
-
- #region Constructors
-
- /// <summary>
- /// Initializes a new instance of the MySqlParameter class.
- /// </summary>
- public MySqlParameter()
- {
- }
-
- /// <summary>
- /// Initializes a new instance of the <see cref="MySqlParameter"/> class with the parameter name and a value of the new MySqlParameter.
- /// </summary>
- /// <param name="parameterName">The name of the parameter to map. </param>
- /// <param name="value">An <see cref="Object"/> that is the value of the <see cref="MySqlParameter"/>. </param>
- public MySqlParameter(string parameterName, object value)
- {
- ParameterName = parameterName;
- paramValue = value;
- dbType = GetMySqlType( paramValue.GetType() );
- genericType = GetGenericType( paramValue.GetType() );
- }
-
- /// <summary>
- /// Initializes a new instance of the <see cref="MySqlParameter"/> class with the parameter name and the data type.
- /// </summary>
- /// <param name="parameterName">The name of the parameter to map. </param>
- /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>
- public MySqlParameter( string parameterName, MySqlDbType dbType)
- {
- ParameterName = parameterName;
- this.dbType = dbType;
- }
-
- /// <summary>
- /// Initializes a new instance of the <see cref="MySqlParameter"/> class with the parameter name, the <see cref="MySqlDbType"/>, and the size.
- /// </summary>
- /// <param name="parameterName">The name of the parameter to map. </param>
- /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>
- /// <param name="size">The length of the parameter. </param>
- public MySqlParameter( string parameterName, MySqlDbType dbType, int size )
- {
- ParameterName = parameterName;
- this.dbType = dbType;
- this.size = size;
- }
-
- /// <summary>
- /// Initializes a new instance of the <see cref="MySqlParameter"/> class with the parameter name, the <see cref="MySqlDbType"/>, the size, and the source column name.
- /// </summary>
- /// <param name="parameterName">The name of the parameter to map. </param>
- /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>
- /// <param name="size">The length of the parameter. </param>
- /// <param name="sourceColumn">The name of the source column. </param>
- public MySqlParameter( string parameterName, MySqlDbType dbType, int size, string sourceColumn )
- {
- ParameterName = parameterName;
- this.dbType = dbType;
- this.size = size;
- this.direction = ParameterDirection.Input;
- this.precision = 0;
- this.scale = 0;
- this.sourceColumn = sourceColumn;
- this.sourceVersion = DataRowVersion.Current;
- this.paramValue =null;
- }
-
- internal MySqlParameter(string name, MySqlDbType type, ParameterDirection dir, string col, DataRowVersion ver, object val)
- {
- if (direction != ParameterDirection.Input)
- throw new ArgumentException("Only input parameters are supported by MySql");
- dbType = type;
- direction = dir;
- ParameterName = name;
- sourceColumn = col;
- sourceVersion = ver;
- paramValue = val;
- }
-
- /// <summary>
- /// Initializes a new instance of the <see cref="MySqlParameter"/> class with the parameter name, the type of the parameter, the size of the parameter, a <see cref="ParameterDirection"/>, the precision of the parameter, the scale of the parameter, the source column, a <see cref="DataRowVersion"/> to use, and the value of the parameter.
- /// </summary>
- /// <param name="parameterName">The name of the parameter to map. </param>
- /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>
- /// <param name="size">The length of the parameter. </param>
- /// <param name="direction">One of the <see cref="ParameterDirection"/> values. </param>
- /// <param name="isNullable">true if the value of the field can be null, otherwise false. </param>
- /// <param name="precision">The total number of digits to the left and right of the decimal point to which <see cref="MySqlParameter.Value"/> is resolved.</param>
- /// <param name="scale">The total number of decimal places to which <see cref="MySqlParameter.Value"/> is resolved. </param>
- /// <param name="sourceColumn">The name of the source column. </param>
- /// <param name="sourceVersion">One of the <see cref="DataRowVersion"/> values. </param>
- /// <param name="value">An <see cref="Object"/> that is the value of the <see cref="MySqlParameter"/>. </param>
- /// <exception cref="ArgumentException"/>
- public MySqlParameter( string parameterName, MySqlDbType dbType, int size, ParameterDirection direction,
- bool isNullable, byte precision, byte scale, string sourceColumn, DataRowVersion sourceVersion,
- object value)
- {
- if (direction != ParameterDirection.Input)
- throw new ArgumentException("Only input parameters are supported by MySql");
-
- ParameterName = parameterName;
- this.dbType = dbType;
- this.size = size;
- this.direction = direction;
- this.precision = precision;
- this.scale = scale;
- this.sourceColumn = sourceColumn;
- this.sourceVersion = sourceVersion;
- this.paramValue = value;
- }
- #endregion
-
- #region Properties
-
- /// <summary>
- /// Gets or sets the <see cref="DbType"/> of the parameter.
- /// </summary>
- public DbType DbType
- {
- get
- {
- return genericType;
- }
- set
- {
- genericType = value;
- switch (genericType)
- {
- case DbType.AnsiString:
- case DbType.AnsiStringFixedLength:
- case DbType.String:
- case DbType.StringFixedLength:
- case DbType.Guid:
- MySqlDbType = MySqlDbType.VarChar; break;
-
- case DbType.Byte:
- case DbType.SByte:
- case DbType.Boolean:
- MySqlDbType = MySqlDbType.Byte; break;
-
- case DbType.Int16:
- case DbType.UInt16:
- MySqlDbType = MySqlDbType.Short; break;
-
- case DbType.Int32:
- case DbType.UInt32:
- MySqlDbType = MySqlDbType.Int; break;
-
- case DbType.Int64:
- case DbType.UInt64:
- MySqlDbType = MySqlDbType.BigInt; break;
-
- case DbType.DateTime:
- MySqlDbType = MySqlDbType.Datetime; break;
-
- case DbType.Date:
- MySqlDbType = MySqlDbType.Date; break;
-
- case DbType.Time:
- MySqlDbType = MySqlDbType.Time; break;
-
- case DbType.Single:
- MySqlDbType = MySqlDbType.Float; break;
- case DbType.Double:
- case DbType.Currency:
- MySqlDbType = MySqlDbType.Double; break;
-
- case DbType.Decimal:
- case DbType.VarNumeric:
- MySqlDbType = MySqlDbType.Decimal; break;
-
- case DbType.Binary:
- case DbType.Object:
- MySqlDbType = MySqlDbType.Blob; break;
- }
- }
- }
-
- /// <summary>
- /// Gets or sets a value indicating whether the parameter is input-only, output-only, bidirectional, or a stored procedure return value parameter.
- /// As of MySql version 4.1 and earlier, input-only is the only valid choice.
- /// </summary>
- [Category("Data")]
- public ParameterDirection Direction
- {
- get { return direction; }
- set { direction = value; }
- }
-
- /// <summary>
- /// Gets or sets a value indicating whether the parameter accepts null values.
- /// </summary>
- [Browsable(false)]
- public Boolean IsNullable
- {
- get { return isNullable; }
- }
-
- /// <summary>
- /// Gets or sets the MySqlDbType of the parameter.
- /// </summary>
- [Category("Data")]
- public MySqlDbType MySqlDbType
- {
- get
- {
- return dbType;
- }
- set
- {
- dbType = value;
- }
- }
-
- /// <summary>
- /// Gets or sets the name of the MySqlParameter.
- /// </summary>
- [Category("Misc")]
- public String ParameterName
- {
- get { return paramName; }
- set
- {
- paramName = value;
- if (paramName[0] == '@')
- paramName = paramName.Substring(1, paramName.Length-1);
- }
- }
-
- /// <summary>
- /// Gets or sets the maximum number of digits used to represent the <see cref="Value"/> property.
- /// </summary>
- [Category("Data")]
- public byte Precision
- {
- get { return precision; }
- set { precision = value; }
- }
-
- /// <summary>
- /// Gets or sets the number of decimal places to which <see cref="Value"/> is resolved.
- /// </summary>
- [Category("Data")]
- public byte Scale
- {
- get { return scale; }
- set { scale = value; }
- }
-
- /// <summary>
- /// Gets or sets the maximum size, in bytes, of the data within the column.
- /// </summary>
- [Category("Data")]
- public int Size
- {
- get { return size; }
- set { size = value; }
- }
-
- /// <summary>
- /// Gets or sets the name of the source column that is mapped to the <see cref="DataSet"/> and used for loading or returning the <see cref="Value"/>.
- /// </summary>
- [Category("Data")]
- public String SourceColumn
- {
- get { return sourceColumn; }
- set { sourceColumn = value; }
- }
-
- /// <summary>
- /// Gets or sets the <see cref="DataRowVersion"/> to use when loading <see cref="Value"/>.
- /// </summary>
- [Category("Data")]
- public DataRowVersion SourceVersion
- {
- get { return sourceVersion; }
- set { sourceVersion = value; }
- }
-
- /// <summary>
- /// Gets or sets the value of the parameter.
- /// </summary>
- [TypeConverter(typeof(StringConverter))]
- [Category("Data")]
- public object Value
- {
- get { return paramValue; }
- set
- {
- paramValue = value;
- if (dbType == MySqlDbType.Null)
- {
- dbType = GetMySqlType( paramValue.GetType() );
- genericType = GetGenericType( paramValue.GetType() );
- }
- }
- }
-
- #endregion
-
- private void EscapeByteArray( byte[] bytes, System.IO.MemoryStream s )
- {
- byte[] newbytes = new byte[ bytes.Length * 2 ];
-
- int newx=0;
- for (int x=0; x < bytes.Length; x++)
- {
- byte b = bytes[x];
- if (b == '\0')
- {
- newbytes[newx++] = (byte)'\\';
- newbytes[newx++] = (byte)'0';
- }
- else
- {
- if (b == '\\' || b == '\'' || b == '"')
- newbytes[newx++] = (byte)'\\';
- newbytes[newx++] = b;
- }
- }
- s.Write( newbytes, 0, newx );
- }
-
- /// <summary>
- /// Overridden. Gets a string containing the <see cref="ParameterName"/>.
- /// </summary>
- /// <returns></returns>
- public override string ToString()
- {
- return paramName;
- }
-
- private string EscapeString( string s )
- {
- StringBuilder sb = new StringBuilder();
-
- foreach (char c in s)
- {
- if (c == '\'')
- sb.Append(c);
- sb.Append(c);
- }
- return sb.ToString();
- }
-
- internal void SerializeToBytes( System.IO.MemoryStream s, MySqlConnection conn )
- {
- string parm_string = null;
- byte[] bytes = null;
-
- //TODO: should value == null throw an exception?
- if (Value == DBNull.Value || Value == null)
- parm_string = "Null";
- else if (paramValue is bool)
- parm_string = Convert.ToByte(paramValue).ToString();
- else
- {
- switch (dbType)
- {
- case MySqlDbType.Null:
- parm_string = "Null";
- break;
-
- case MySqlDbType.VarChar:
- case MySqlDbType.String:
- parm_string = "'" + EscapeString(Value.ToString()) + "'";
- break;
-
- case MySqlDbType.Double:
- parm_string = Convert.ToDouble(Value).ToString( conn.NumberFormat );
- break;
-
- case MySqlDbType.Float:
- parm_string = Convert.ToSingle(Value).ToString( conn.NumberFormat );
- break;
-
- case MySqlDbType.Decimal:
- parm_string = Convert.ToDecimal(Value).ToString( conn.NumberFormat );
- break;
-
- case MySqlDbType.Time:
- if (Value is DateTime)
- parm_string = String.Format("'{0:HH:mm:ss}'", ((DateTime)Value));
- else
- parm_string = String.Format("'{0}'", Value.ToString());
- break;
-
- case MySqlDbType.Date:
- if (Value is DateTime)
- parm_string = String.Format("'{0:yyyy-MM-dd}'", ((DateTime)Value));
- else
- parm_string = "'" + Value.ToString() + "'";
- break;
-
- case MySqlDbType.Datetime:
- if (Value is DateTime)
- parm_string = String.Format("'{0:yyyy-MM-dd HH:mm:ss}'", ((DateTime)Value));
- else
- parm_string = "'" + Value + "'";
- break;
-
- case MySqlDbType.Blob:
- case MySqlDbType.MediumBlob:
- case MySqlDbType.LongBlob:
- case MySqlDbType.TinyBlob:
- Type t = paramValue.GetType();
-
- if (t == typeof(System.Byte[]))
- {
- s.WriteByte((byte)'\'');
- EscapeByteArray( (byte[])paramValue, s );
- s.WriteByte((byte)'\'');
- return;
- }
- else if(t == typeof(string))
- parm_string = "'" + EscapeString((string)paramValue) + "'";
- else if (t == typeof(System.Guid))
- {
- parm_string = "'" + paramValue.ToString() + "'";
- }
- break;
-
- default:
- parm_string = Value.ToString();
- break;
- }
- }
-
- bytes = conn.Encoding.GetBytes(parm_string);
- s.Write(bytes, 0, bytes.Length);
- }
-
- private DbType GetGenericType( Type systemType )
- {
- switch ( Type.GetTypeCode(systemType) )
- {
- case TypeCode.Boolean: return DbType.Boolean;
- case TypeCode.Byte: return DbType.Byte;
- case TypeCode.Char: return DbType.StringFixedLength;
- case TypeCode.DateTime: return DbType.DateTime;
- case TypeCode.Decimal: return DbType.Decimal;
- case TypeCode.Double: return DbType.Double;
- case TypeCode.Int16: return DbType.Int16;
- case TypeCode.Int32: return DbType.Int32;
- case TypeCode.Int64: return DbType.Int64;
- case TypeCode.Object: return DbType.Binary;
- case TypeCode.SByte: return DbType.SByte;
- case TypeCode.Single: return DbType.Single;
- case TypeCode.String: return DbType.String;
- case TypeCode.UInt16: return DbType.UInt16;
- case TypeCode.UInt32: return DbType.UInt32;
- case TypeCode.UInt64: return DbType.UInt64;
- }
- return DbType.Object;
- }
-
- private MySqlDbType GetMySqlType( Type systemType )
- {
- switch (Type.GetTypeCode( systemType ))
- {
- case TypeCode.Empty:
- throw new SystemException("Invalid data type");
-
- case TypeCode.Object: return MySqlDbType.Blob;
- case TypeCode.DBNull: return MySqlDbType.Null;
- case TypeCode.Char:
- case TypeCode.SByte:
- case TypeCode.Boolean:
- case TypeCode.Byte: return MySqlDbType.Byte;
- case TypeCode.Int16:
- case TypeCode.UInt16: return MySqlDbType.Int24;
- case TypeCode.Int32:
- case TypeCode.UInt32: return MySqlDbType.Int;
- case TypeCode.Int64:
- case TypeCode.UInt64: return MySqlDbType.BigInt;
- case TypeCode.Single: return MySqlDbType.Float;
- case TypeCode.Double: return MySqlDbType.Double;
- case TypeCode.Decimal: return MySqlDbType.Decimal;
- case TypeCode.DateTime: return MySqlDbType.Datetime;
- case TypeCode.String: return MySqlDbType.VarChar;
-
- default:
- throw new SystemException("Value is of unknown data type");
- }
- }
-
-
- #region ICloneable
- object System.ICloneable.Clone()
- {
- MySqlParameter clone = new MySqlParameter( paramName, dbType, direction,
- sourceColumn, sourceVersion, paramValue );
- return clone;
- }
- #endregion
-
- /* A TypeConverter for the Triangle object. Note that you can make it internal,
- private, or any scope you want and the designers will still be able to use
- it through the TypeDescriptor object. This type converter provides the
- capability to convert to an InstanceDescriptor. This object can be used by
- the .NET Framework to generate source code that creates an instance of a
- Triangle object. */
- internal class MySqlParameterConverter : TypeConverter
- {
- /* This method overrides CanConvertTo from TypeConverter. This is called when someone
- wants to convert an instance of Triangle to another type. Here,
- only conversion to an InstanceDescriptor is supported. */
- public override bool CanConvertTo(ITypeDescriptorContext context, Type destinationType)
- {
- if (destinationType == typeof(InstanceDescriptor))
- {
- return true;
- }
-
- // Always call the base to see if it can perform the conversion.
- return base.CanConvertTo(context, destinationType);
- }
-
- /* This code performs the actual conversion from a Triangle to an InstanceDescriptor. */
- public override object ConvertTo(ITypeDescriptorContext context,
- System.Globalization.CultureInfo culture, object value, Type destinationType)
- {
- if (destinationType == typeof(InstanceDescriptor))
- {
- ConstructorInfo ci = typeof(MySqlParameter).GetConstructor(
- new Type[]{typeof(string), typeof(MySqlDbType), typeof(int), typeof(ParameterDirection),
- typeof(bool), typeof(byte), typeof(byte), typeof(string), typeof(DataRowVersion),
- typeof(object)});
- MySqlParameter p = (MySqlParameter) value;
- return new InstanceDescriptor(ci,new object[]{
- p.ParameterName, p.DbType, p.Size, p.Direction, p.IsNullable, p.Precision,
- p.Scale, p.SourceColumn, p.SourceVersion, p.Value});
- }
-
- // Always call base, even if you can't convert.
- return base.ConvertTo(context, culture, value, destinationType);
- }
- }
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Data;\r
+using System.Text;\r
+using System.ComponentModel;\r
+using System.ComponentModel.Design.Serialization;\r
+using System.Reflection;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Represents a parameter to a <see cref="MySqlCommand"/>, and optionally, its mapping to <see cref="DataSet"/> columns. This class cannot be inherited.\r
+ /// </summary>\r
+ [TypeConverter(typeof(MySqlParameter.MySqlParameterConverter))]\r
+ public sealed class MySqlParameter : MarshalByRefObject, IDataParameter, IDbDataParameter, ICloneable\r
+ {\r
+ private MySqlDbType dbType = MySqlDbType.Null;\r
+ private DbType genericType;\r
+ private ParameterDirection direction = ParameterDirection.Input;\r
+ private bool isNullable = false;\r
+ private string paramName;\r
+ private string sourceColumn;\r
+ private DataRowVersion sourceVersion = DataRowVersion.Current;\r
+ private object paramValue = DBNull.Value;\r
+ private int size;\r
+ private byte precision=0, scale=0;\r
+\r
+ #region Constructors\r
+\r
+ /// <summary>\r
+ /// Initializes a new instance of the MySqlParameter class.\r
+ /// </summary>\r
+ public MySqlParameter()\r
+ {\r
+ }\r
+\r
+ /// <summary>\r
+ /// Initializes a new instance of the <see cref="MySqlParameter"/> class with the parameter name and a value of the new MySqlParameter.\r
+ /// </summary>\r
+ /// <param name="parameterName">The name of the parameter to map. </param>\r
+ /// <param name="value">An <see cref="Object"/> that is the value of the <see cref="MySqlParameter"/>. </param>\r
+ public MySqlParameter(string parameterName, object value)\r
+ {\r
+ ParameterName = parameterName;\r
+ paramValue = value;\r
+ if (value is Byte[])\r
+ size = (value as Byte[]).Length;\r
+ dbType = GetMySqlType();\r
+ genericType = GetGenericType();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Initializes a new instance of the <see cref="MySqlParameter"/> class with the parameter name and the data type.\r
+ /// </summary>\r
+ /// <param name="parameterName">The name of the parameter to map. </param>\r
+ /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>\r
+ public MySqlParameter( string parameterName, MySqlDbType dbType)\r
+ {\r
+ ParameterName = parameterName;\r
+ this.dbType = dbType;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Initializes a new instance of the <see cref="MySqlParameter"/> class with the parameter name, the <see cref="MySqlDbType"/>, and the size.\r
+ /// </summary>\r
+ /// <param name="parameterName">The name of the parameter to map. </param>\r
+ /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>\r
+ /// <param name="size">The length of the parameter. </param>\r
+ public MySqlParameter( string parameterName, MySqlDbType dbType, int size )\r
+ {\r
+ ParameterName = parameterName;\r
+ this.dbType = dbType;\r
+ this.size = size;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Initializes a new instance of the <see cref="MySqlParameter"/> class with the parameter name, the <see cref="MySqlDbType"/>, the size, and the source column name.\r
+ /// </summary>\r
+ /// <param name="parameterName">The name of the parameter to map. </param>\r
+ /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>\r
+ /// <param name="size">The length of the parameter. </param>\r
+ /// <param name="sourceColumn">The name of the source column. </param>\r
+ public MySqlParameter( string parameterName, MySqlDbType dbType, int size, string sourceColumn )\r
+ {\r
+ ParameterName = parameterName;\r
+ this.dbType = dbType;\r
+ this.size = size;\r
+ this.direction = ParameterDirection.Input;\r
+ this.precision = 0;\r
+ this.scale = 0;\r
+ this.sourceColumn = sourceColumn;\r
+ this.sourceVersion = DataRowVersion.Current;\r
+ this.paramValue =null;\r
+ }\r
+\r
+ internal MySqlParameter(string name, MySqlDbType type, ParameterDirection dir, string col, DataRowVersion ver, object val)\r
+ {\r
+ if (direction != ParameterDirection.Input)\r
+ throw new ArgumentException("Only input parameters are supported by MySql");\r
+ dbType = type;\r
+ direction = dir;\r
+ ParameterName = name;\r
+ sourceColumn = col;\r
+ sourceVersion = ver;\r
+ paramValue = val;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Initializes a new instance of the <see cref="MySqlParameter"/> class with the parameter name, the type of the parameter, the size of the parameter, a <see cref="ParameterDirection"/>, the precision of the parameter, the scale of the parameter, the source column, a <see cref="DataRowVersion"/> to use, and the value of the parameter.\r
+ /// </summary>\r
+ /// <param name="parameterName">The name of the parameter to map. </param>\r
+ /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>\r
+ /// <param name="size">The length of the parameter. </param>\r
+ /// <param name="direction">One of the <see cref="ParameterDirection"/> values. </param>\r
+ /// <param name="isNullable">true if the value of the field can be null, otherwise false. </param>\r
+ /// <param name="precision">The total number of digits to the left and right of the decimal point to which <see cref="MySqlParameter.Value"/> is resolved.</param>\r
+ /// <param name="scale">The total number of decimal places to which <see cref="MySqlParameter.Value"/> is resolved. </param>\r
+ /// <param name="sourceColumn">The name of the source column. </param>\r
+ /// <param name="sourceVersion">One of the <see cref="DataRowVersion"/> values. </param>\r
+ /// <param name="value">An <see cref="Object"/> that is the value of the <see cref="MySqlParameter"/>. </param>\r
+ /// <exception cref="ArgumentException"/>\r
+ public MySqlParameter( string parameterName, MySqlDbType dbType, int size, ParameterDirection direction,\r
+ bool isNullable, byte precision, byte scale, string sourceColumn, DataRowVersion sourceVersion,\r
+ object value)\r
+ {\r
+ if (direction != ParameterDirection.Input)\r
+ throw new ArgumentException("Only input parameters are supported by MySql");\r
+\r
+ ParameterName = parameterName;\r
+ this.dbType = dbType;\r
+ this.size = size;\r
+ this.direction = direction;\r
+ this.precision = precision;\r
+ this.scale = scale;\r
+ this.sourceColumn = sourceColumn;\r
+ this.sourceVersion = sourceVersion;\r
+ this.paramValue = value;\r
+ }\r
+ #endregion\r
+\r
+ #region Properties\r
+\r
+ /// <summary>\r
+ /// Gets or sets the <see cref="DbType"/> of the parameter.\r
+ /// </summary>\r
+ public DbType DbType \r
+ {\r
+ get \r
+ { \r
+ return genericType; \r
+ }\r
+ set \r
+ { \r
+ genericType = value; \r
+ switch (genericType) \r
+ {\r
+ case DbType.AnsiString:\r
+ case DbType.AnsiStringFixedLength:\r
+ case DbType.String:\r
+ case DbType.StringFixedLength:\r
+ case DbType.Guid:\r
+ MySqlDbType = MySqlDbType.VarChar; break;\r
+\r
+ case DbType.Byte:\r
+ case DbType.SByte:\r
+ case DbType.Boolean:\r
+ MySqlDbType = MySqlDbType.Byte; break;\r
+\r
+ case DbType.Int16:\r
+ case DbType.UInt16:\r
+ MySqlDbType = MySqlDbType.Short; break;\r
+\r
+ case DbType.Int32:\r
+ case DbType.UInt32:\r
+ MySqlDbType = MySqlDbType.Int; break;\r
+ \r
+ case DbType.Int64:\r
+ case DbType.UInt64:\r
+ MySqlDbType = MySqlDbType.BigInt; break;\r
+\r
+ case DbType.DateTime:\r
+ MySqlDbType = MySqlDbType.Datetime; break;\r
+\r
+ case DbType.Date:\r
+ MySqlDbType = MySqlDbType.Date; break;\r
+\r
+ case DbType.Time:\r
+ MySqlDbType = MySqlDbType.Time; break;\r
+\r
+ case DbType.Single:\r
+ MySqlDbType = MySqlDbType.Float; break;\r
+ case DbType.Double:\r
+ case DbType.Currency:\r
+ MySqlDbType = MySqlDbType.Double; break;\r
+\r
+ case DbType.Decimal:\r
+ case DbType.VarNumeric:\r
+ MySqlDbType = MySqlDbType.Decimal; break;\r
+\r
+ case DbType.Binary:\r
+ case DbType.Object:\r
+ MySqlDbType = MySqlDbType.Blob; break;\r
+ }\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets a value indicating whether the parameter is input-only, output-only, bidirectional, or a stored procedure return value parameter.\r
+ /// As of MySql version 4.1 and earlier, input-only is the only valid choice.\r
+ /// </summary>\r
+ [Category("Data")]\r
+ public ParameterDirection Direction \r
+ {\r
+ get { return direction; }\r
+ set { direction = value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets a value indicating whether the parameter accepts null values.\r
+ /// </summary>\r
+ [Browsable(false)]\r
+ public Boolean IsNullable \r
+ {\r
+ get { return isNullable; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the MySqlDbType of the parameter.\r
+ /// </summary>\r
+ [Category("Data")]\r
+ public MySqlDbType MySqlDbType \r
+ {\r
+ get \r
+ { \r
+ return dbType; \r
+ }\r
+ set \r
+ { \r
+ dbType = value; \r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the name of the MySqlParameter.\r
+ /// </summary>\r
+ [Category("Misc")]\r
+ public String ParameterName \r
+ {\r
+ get { return paramName; }\r
+ set \r
+ { \r
+ paramName = value; \r
+ if (paramName[0] == '@')\r
+ paramName = paramName.Substring(1, paramName.Length-1);\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the maximum number of digits used to represent the <see cref="Value"/> property.\r
+ /// </summary>\r
+ [Category("Data")]\r
+ public byte Precision \r
+ {\r
+ get { return precision; }\r
+ set { precision = value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the number of decimal places to which <see cref="Value"/> is resolved.\r
+ /// </summary>\r
+ [Category("Data")]\r
+ public byte Scale \r
+ {\r
+ get { return scale; }\r
+ set { scale = value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the maximum size, in bytes, of the data within the column.\r
+ /// </summary>\r
+ [Category("Data")]\r
+ public int Size \r
+ {\r
+ get { return size; }\r
+ set { size = value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the name of the source column that is mapped to the <see cref="DataSet"/> and used for loading or returning the <see cref="Value"/>.\r
+ /// </summary>\r
+ [Category("Data")]\r
+ public String SourceColumn \r
+ {\r
+ get { return sourceColumn; }\r
+ set { sourceColumn = value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the <see cref="DataRowVersion"/> to use when loading <see cref="Value"/>.\r
+ /// </summary>\r
+ [Category("Data")]\r
+ public DataRowVersion SourceVersion \r
+ {\r
+ get { return sourceVersion; }\r
+ set { sourceVersion = value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets or sets the value of the parameter.\r
+ /// </summary>\r
+ [TypeConverter(typeof(StringConverter))]\r
+ [Category("Data")]\r
+ public object Value \r
+ {\r
+ get { return paramValue; }\r
+ set \r
+ { \r
+ paramValue = value; \r
+ if (dbType == MySqlDbType.Null) \r
+ {\r
+ dbType = GetMySqlType();\r
+ genericType = GetGenericType();\r
+ }\r
+ }\r
+ }\r
+\r
+ #endregion\r
+\r
+ private void EscapeByteArray( byte[] bytes, System.IO.MemoryStream s )\r
+ {\r
+ int theSize = size == 0 ? bytes.Length : size;\r
+ byte[] newbytes = new byte[ theSize * 2 ];\r
+\r
+ int newx=0;\r
+ for (int x=0; x < theSize; x++)\r
+ {\r
+ byte b = bytes[x];\r
+ if (b == '\0') \r
+ {\r
+ newbytes[newx++] = (byte)'\\';\r
+ newbytes[newx++] = (byte)'0';\r
+ }\r
+ else \r
+ {\r
+ if (b == '\\' || b == '\'' || b == '"' || b == '`' || b == '´')\r
+ newbytes[newx++] = (byte)'\\';\r
+ newbytes[newx++] = b;\r
+ }\r
+ }\r
+ s.Write( newbytes, 0, newx );\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overridden. Gets a string containing the <see cref="ParameterName"/>.\r
+ /// </summary>\r
+ /// <returns></returns>\r
+ public override string ToString() \r
+ {\r
+ return paramName;\r
+ }\r
+\r
+ private string EscapeString( string s )\r
+ {\r
+ s = s.Replace("\'", "\\\'");\r
+ s = s.Replace("\"", "\\\"");\r
+ return s;\r
+ }\r
+\r
+ internal void SerializeToBytes( System.IO.MemoryStream s, MySqlConnection conn )\r
+ {\r
+ string parm_string = null;\r
+ byte[] bytes = null;\r
+\r
+ //TODO: should value == null throw an exception?\r
+ if (Value == DBNull.Value || Value == null)\r
+ parm_string = "Null";\r
+ else if (paramValue is bool)\r
+ parm_string = Convert.ToByte(paramValue).ToString();\r
+ else if (paramValue is Enum)\r
+ parm_string = ((int)paramValue).ToString();\r
+ else \r
+ {\r
+ switch (dbType) \r
+ {\r
+ case MySqlDbType.Null:\r
+ parm_string = "Null";\r
+ break;\r
+\r
+ case MySqlDbType.VarChar:\r
+ case MySqlDbType.String:\r
+ parm_string = "'" + EscapeString(Value.ToString()) + "'";\r
+ break;\r
+\r
+ case MySqlDbType.Double:\r
+ parm_string = Convert.ToDouble(Value).ToString( conn.NumberFormat );\r
+ break;\r
+\r
+ case MySqlDbType.Float:\r
+ parm_string = Convert.ToSingle(Value).ToString( conn.NumberFormat );\r
+ break;\r
+\r
+ case MySqlDbType.Decimal:\r
+ parm_string = Convert.ToDecimal(Value).ToString( conn.NumberFormat );\r
+ break;\r
+\r
+ case MySqlDbType.Time:\r
+ if (Value is DateTime)\r
+ parm_string = String.Format("'{0:HH:mm:ss}'", ((DateTime)Value));\r
+ else \r
+ parm_string = String.Format("'{0}'", Value.ToString());\r
+ break;\r
+\r
+ case MySqlDbType.Date:\r
+ if (Value is DateTime)\r
+ parm_string = String.Format("'{0:yyyy-MM-dd}'", ((DateTime)Value));\r
+ else \r
+ parm_string = "'" + Value.ToString() + "'";\r
+ break;\r
+\r
+ case MySqlDbType.Datetime:\r
+ if (Value is DateTime)\r
+ parm_string = String.Format("'{0:yyyy-MM-dd HH:mm:ss}'", ((DateTime)Value));\r
+ else\r
+ parm_string = "'" + Value + "'";\r
+ break;\r
+\r
+ case MySqlDbType.Blob:\r
+ case MySqlDbType.MediumBlob:\r
+ case MySqlDbType.LongBlob:\r
+ case MySqlDbType.TinyBlob:\r
+ Type t = paramValue.GetType();\r
+\r
+ if (t == typeof(System.Byte[]))\r
+ {\r
+ s.WriteByte((byte)'\'');\r
+ EscapeByteArray( (byte[])paramValue, s );\r
+ s.WriteByte((byte)'\'');\r
+ return;\r
+ }\r
+ else if(t == typeof(string)) \r
+ parm_string = "'" + EscapeString((string)paramValue) + "'";\r
+ else if (t == typeof(System.Guid))\r
+ {\r
+ parm_string = "'" + paramValue.ToString() + "'";\r
+ }\r
+ break;\r
+\r
+ case MySqlDbType.Int:\r
+ case MySqlDbType.Int24:\r
+ parm_string = Convert.ToInt32( Value.ToString() ).ToString();\r
+ break;\r
+ \r
+ case MySqlDbType.BigInt:\r
+ parm_string = Convert.ToInt64( Value.ToString() ).ToString();\r
+ break;\r
+\r
+ case MySqlDbType.Short:\r
+ parm_string = Convert.ToInt16( Value.ToString() ).ToString();\r
+ break;\r
+\r
+ default:\r
+ parm_string = Value.ToString();\r
+ break;\r
+ }\r
+ }\r
+\r
+ bytes = conn.Encoding.GetBytes(parm_string);\r
+ s.Write(bytes, 0, bytes.Length);\r
+ }\r
+\r
+ private DbType GetGenericType()\r
+ {\r
+ if (paramValue is TimeSpan)\r
+ return DbType.DateTime;\r
+ if (paramValue is Enum)\r
+ return DbType.Int32;\r
+ if (paramValue is Guid)\r
+ return DbType.String;\r
+\r
+ switch ( Type.GetTypeCode(paramValue.GetType()) )\r
+ {\r
+ case TypeCode.Boolean: return DbType.Boolean;\r
+ case TypeCode.Byte: return DbType.Byte;\r
+ case TypeCode.Char: return DbType.StringFixedLength;\r
+ case TypeCode.DateTime: return DbType.DateTime;\r
+ case TypeCode.Decimal: return DbType.Decimal;\r
+ case TypeCode.Double: return DbType.Double;\r
+ case TypeCode.Int16: return DbType.Int16;\r
+ case TypeCode.Int32: return DbType.Int32;\r
+ case TypeCode.Int64: return DbType.Int64;\r
+ case TypeCode.Object: return DbType.Binary;\r
+ case TypeCode.SByte: return DbType.SByte;\r
+ case TypeCode.Single: return DbType.Single;\r
+ case TypeCode.String: return DbType.String;\r
+ case TypeCode.UInt16: return DbType.UInt16;\r
+ case TypeCode.UInt32: return DbType.UInt32;\r
+ case TypeCode.UInt64: return DbType.UInt64;\r
+ }\r
+ return DbType.Object;\r
+ }\r
+\r
+ private MySqlDbType GetMySqlType()\r
+ {\r
+ if (paramValue is System.TimeSpan)\r
+ return MySqlDbType.Time;\r
+ if (paramValue is Enum)\r
+ return MySqlDbType.Int;\r
+ if (paramValue is Guid)\r
+ return MySqlDbType.String;\r
+\r
+ switch (Type.GetTypeCode( paramValue.GetType() ))\r
+ {\r
+ case TypeCode.Empty:\r
+ throw new SystemException("Invalid data type");\r
+\r
+ case TypeCode.Object: return MySqlDbType.Blob;\r
+ case TypeCode.DBNull: return MySqlDbType.Null;\r
+ case TypeCode.Char:\r
+ case TypeCode.SByte:\r
+ case TypeCode.Boolean:\r
+ case TypeCode.Byte: return MySqlDbType.Byte;\r
+ case TypeCode.Int16:\r
+ case TypeCode.UInt16: return MySqlDbType.Int24;\r
+ case TypeCode.Int32:\r
+ case TypeCode.UInt32: return MySqlDbType.Int;\r
+ case TypeCode.Int64:\r
+ case TypeCode.UInt64: return MySqlDbType.BigInt;\r
+ case TypeCode.Single: return MySqlDbType.Float;\r
+ case TypeCode.Double: return MySqlDbType.Double;\r
+ case TypeCode.Decimal: return MySqlDbType.Decimal;\r
+ case TypeCode.DateTime: return MySqlDbType.Datetime;\r
+ case TypeCode.String: return MySqlDbType.VarChar;\r
+\r
+ default:\r
+ throw new SystemException("Value is of unknown data type");\r
+ }\r
+ }\r
+\r
+\r
+ #region ICloneable\r
+ object System.ICloneable.Clone() \r
+ {\r
+ MySqlParameter clone = new MySqlParameter( paramName, dbType, direction,\r
+ sourceColumn, sourceVersion, paramValue );\r
+ return clone;\r
+ }\r
+ #endregion\r
+\r
+ internal class MySqlParameterConverter : TypeConverter\r
+ {\r
+ public override bool CanConvertTo(ITypeDescriptorContext context, Type destinationType)\r
+ {\r
+ if (destinationType == typeof(InstanceDescriptor))\r
+ {\r
+ return true;\r
+ }\r
+\r
+ // Always call the base to see if it can perform the conversion.\r
+ return base.CanConvertTo(context, destinationType);\r
+ }\r
+\r
+ public override object ConvertTo(ITypeDescriptorContext context, \r
+ System.Globalization.CultureInfo culture, object value, Type destinationType)\r
+ {\r
+ if (destinationType == typeof(InstanceDescriptor))\r
+ {\r
+ ConstructorInfo ci = typeof(MySqlParameter).GetConstructor(\r
+ new Type[]{typeof(string), typeof(MySqlDbType), typeof(int), typeof(ParameterDirection),\r
+ typeof(bool), typeof(byte), typeof(byte), typeof(string), typeof(DataRowVersion),\r
+ typeof(object)});\r
+ MySqlParameter p = (MySqlParameter) value;\r
+ return new InstanceDescriptor(ci,new object[]{ \r
+ p.ParameterName, p.DbType, p.Size, p.Direction, p.IsNullable, p.Precision,\r
+ p.Scale, p.SourceColumn, p.SourceVersion, p.Value});\r
+ }\r
+\r
+ // Always call base, even if you can't convert.\r
+ return base.ConvertTo(context, culture, value, destinationType);\r
+ }\r
+ }\r
+ }\r
+}\r
-// ByteFX.Data data access components for .Net
-// Copyright (C) 2002-2003 ByteFX, Inc.
-//
-// This library is free software; you can redistribute it and/or
-// modify it under the terms of the GNU Lesser General Public
-// License as published by the Free Software Foundation; either
-// version 2.1 of the License, or (at your option) any later version.
-//
-// This library is distributed in the hope that it will be useful,
-// but WITHOUT ANY WARRANTY; without even the implied warranty of
-// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
-// Lesser General Public License for more details.
-//
-// You should have received a copy of the GNU Lesser General Public
-// License along with this library; if not, write to the Free Software
-// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
-
-using System;
-using System.Data;
-using System.Collections;
-using System.ComponentModel;
-
-namespace ByteFX.Data.MySqlClient
-{
- /// <summary>
- /// Represents a collection of parameters relevant to a <see cref="MySqlCommand"/> as well as their respective mappings to columns in a <see cref="DataSet"/>. This class cannot be inherited.
- /// </summary>
- /// <include file='docs/MySqlParameterCollection.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>
- [Editor(typeof(ByteFX.Data.Common.DBParametersEditor), typeof(System.Drawing.Design.UITypeEditor))]
- [ListBindable(true)]
- public sealed class MySqlParameterCollection : MarshalByRefObject, IDataParameterCollection,
- IList, ICollection, IEnumerable
- {
- private ArrayList _parms = new ArrayList();
-
- #region ICollection support
-
- /// <summary>
- /// Gets the number of MySqlParameter objects in the collection.
- /// </summary>
- public int Count
- {
- get { return _parms.Count; }
- }
-
- /// <summary>
- /// Copies MySqlParameter objects from the MySqlParameterCollection to the specified array.
- /// </summary>
- /// <param name="array"></param>
- /// <param name="index"></param>
- public void CopyTo( Array array, int index )
- {
- _parms.CopyTo(array, index);
- }
-
- bool ICollection.IsSynchronized
- {
- get { return _parms.IsSynchronized; }
- }
-
- object ICollection.SyncRoot
- {
- get { return _parms.SyncRoot; }
- }
- #endregion
-
- #region IList
-
- /// <summary>
- /// Removes all items from the collection.
- /// </summary>
- public void Clear()
- {
- _parms.Clear();
- }
-
- /// <summary>
- /// Gets a value indicating whether a MySqlParameter exists in the collection.
- /// </summary>
- /// <param name="value">The value of the <see cref="MySqlParameter"/> object to find. </param>
- /// <returns>true if the collection contains the <see cref="MySqlParameter"/> object; otherwise, false.</returns>
- /// <overloads>Gets a value indicating whether a <see cref="MySqlParameter"/> exists in the collection.</overloads>
- public bool Contains(object value)
- {
- return _parms.Contains(value);
- }
-
- /// <summary>
- /// Gets the location of a <see cref="MySqlParameter"/> in the collection.
- /// </summary>
- /// <param name="value">The <see cref="MySqlParameter"/> object to locate. </param>
- /// <returns>The zero-based location of the <see cref="MySqlParameter"/> in the collection.</returns>
- /// <overloads>Gets the location of a <see cref="MySqlParameter"/> in the collection.</overloads>
- public int IndexOf(object value)
- {
- return _parms.IndexOf(value);
- }
-
- /// <summary>
- /// Inserts a MySqlParameter into the collection at the specified index.
- /// </summary>
- /// <param name="index"></param>
- /// <param name="value"></param>
- public void Insert(int index, object value)
- {
- _parms.Insert( index, value );
- }
-
- bool IList.IsFixedSize
- {
- get { return _parms.IsFixedSize; }
- }
-
- bool IList.IsReadOnly
- {
- get { return _parms.IsReadOnly; }
- }
-
- /// <summary>
- /// Removes the specified MySqlParameter from the collection.
- /// </summary>
- /// <param name="value"></param>
- public void Remove( object value )
- {
- _parms.Remove( value );
- }
-
- /// <summary>
- /// Removes the specified <see cref="MySqlParameter"/> from the collection using a specific index.
- /// </summary>
- /// <param name="index">The zero-based index of the parameter. </param>
- /// <overloads>Removes the specified <see cref="MySqlParameter"/> from the collection.</overloads>
- public void RemoveAt( int index )
- {
- _parms.RemoveAt( index );
- }
-
- object IList.this[int index]
- {
- get { return this[index]; }
- set
- {
- if (! (value is MySqlParameter)) throw new MySqlException("Only MySqlParameter objects may be stored");
- this[index] = (MySqlParameter)value;
- }
- }
-
- /// <summary>
- /// Adds the specified <see cref="MySqlParameter"/> object to the <see cref="MySqlParameterCollection"/>.
- /// </summary>
- /// <param name="value">The <see cref="MySqlParameter"/> to add to the collection.</param>
- /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>
- public int Add( object value )
- {
- if (! (value is MySqlParameter)) throw new MySqlException("Only MySqlParameter objects may be stored");
-
- MySqlParameter p = (MySqlParameter)value;
-
- if (p.ParameterName == null || p.ParameterName == String.Empty)
- throw new MySqlException("Parameters must be named");
-
- return _parms.Add(value);
- }
-
- #endregion
-
- #region IDataParameterCollection
-
- /// <summary>
- /// Gets a value indicating whether a <see cref="MySqlParameter"/> with the specified parameter name exists in the collection.
- /// </summary>
- /// <param name="name">The name of the <see cref="MySqlParameter"/> object to find.</param>
- /// <returns>true if the collection contains the parameter; otherwise, false.</returns>
- public bool Contains(string name)
- {
- if (name[0] == '@')
- name = name.Substring(1, name.Length-1);
- foreach (MySqlParameter p in _parms)
- {
- if (p.ParameterName.ToLower().Equals( name.ToLower() )) return true;
- }
- return false;
- }
-
- /// <summary>
- /// Gets the location of the <see cref="MySqlParameter"/> in the collection with a specific parameter name.
- /// </summary>
- /// <param name="parameterName">The name of the <see cref="MySqlParameter"/> object to retrieve. </param>
- /// <returns>The zero-based location of the <see cref="MySqlParameter"/> in the collection.</returns>
- public int IndexOf( string parameterName )
- {
- if (parameterName[0] == '@')
- parameterName = parameterName.Substring(1, parameterName.Length-1);
- for (int x=0; x < _parms.Count; x++)
- {
- MySqlParameter p = (MySqlParameter)_parms[x];
- if (p.ParameterName.ToLower().Equals( parameterName.ToLower() )) return x;
- }
- throw new MySqlException("Parameter '" + parameterName + "' not found in collection");
- }
-
- /// <summary>
- /// Removes the specified <see cref="MySqlParameter"/> from the collection using the parameter name.
- /// </summary>
- /// <param name="name">The name of the <see cref="MySqlParameter"/> object to retrieve. </param>
- public void RemoveAt( string name )
- {
- int index = IndexOf( name );
- _parms.RemoveAt(index);
- }
-
- object IDataParameterCollection.this[string name]
- {
- get { return this[name]; }
- set
- {
- if (! (value is MySqlParameter)) throw new MySqlException("Only MySqlParameter objects may be stored");
- this[name] = (MySqlParameter)value;
- }
- }
- #endregion
-
- #region IEnumerable
- IEnumerator IEnumerable.GetEnumerator()
- {
- return ((IEnumerable)_parms).GetEnumerator();
- }
- #endregion
-
- #region Public Methods
-
- /// <summary>
- /// Gets the <see cref="MySqlParameter"/> at the specified index.
- /// </summary>
- /// <overloads>Gets the <see cref="MySqlParameter"/> with a specified attribute.
- /// [C#] In C#, this property is the indexer for the <see cref="MySqlParameterCollection"/> class.
- /// </overloads>
- public MySqlParameter this[int index]
- {
- get { return (MySqlParameter)_parms[index]; }
- set { _parms[index] = value; }
- }
-
- /// <summary>
- /// Gets the <see cref="MySqlParameter"/> with the specified name.
- /// </summary>
- public MySqlParameter this[string name]
- {
- get { return (MySqlParameter)_parms[ IndexOf( name ) ]; }
- set { _parms[ IndexOf( name ) ] = value; }
- }
-
- /// <summary>
- /// Adds the specified <see cref="MySqlParameter"/> object to the <see cref="MySqlParameterCollection"/>.
- /// </summary>
- /// <param name="value">The <see cref="MySqlParameter"/> to add to the collection.</param>
- /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>
- public MySqlParameter Add(MySqlParameter value)
- {
- if ( value.ParameterName == null ) throw new ArgumentException("parameter must be named");
-
- _parms.Add(value);
- return value;
- }
-
- /// <summary>
- /// Adds a <see cref="MySqlParameter"/> to the <see cref="MySqlParameterCollection"/> given the specified parameter name and value.
- /// </summary>
- /// <param name="parameterName">The name of the parameter.</param>
- /// <param name="value">The <see cref="MySqlParameter.Value"/> of the <see cref="MySqlParameter"/> to add to the collection.</param>
- /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>
- public MySqlParameter Add( string parameterName, object value )
- {
- return Add( new MySqlParameter( parameterName, value ) );
- }
-
- /// <summary>
- /// Adds a <see cref="MySqlParameter"/> to the <see cref="MySqlParameterCollection"/> given the parameter name and the data type.
- /// </summary>
- /// <param name="parameterName">The name of the parameter.</param>
- /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>
- /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>
- public MySqlParameter Add(string parameterName, MySqlDbType dbType)
- {
- return Add(new MySqlParameter(parameterName, dbType));
- }
-
- /// <summary>
- /// Adds a <see cref="MySqlParameter"/> to the <see cref="MySqlParameterCollection"/> with the parameter name, the data type, and the column length.
- /// </summary>
- /// <param name="parameterName">The name of the parameter.</param>
- /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>
- /// <param name="size">The length of the column.</param>
- /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>
- public MySqlParameter Add(string parameterName, MySqlDbType dbType, int size)
- {
- return Add(new MySqlParameter(parameterName, dbType, size ));
- }
-
- /// <summary>
- /// Adds a <see cref="MySqlParameter"/> to the <see cref="MySqlParameterCollection"/> with the parameter name, the data type, the column length, and the source column name.
- /// </summary>
- /// <param name="parameterName">The name of the parameter.</param>
- /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>
- /// <param name="size">The length of the column.</param>
- /// <param name="sourceColumn">The name of the source column.</param>
- /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>
- public MySqlParameter Add(string parameterName, MySqlDbType dbType, int size, string sourceColumn)
- {
- return Add(new MySqlParameter(parameterName, dbType, size, sourceColumn));
- }
-
- #endregion
-
- }
-}
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Data;\r
+using System.Collections;\r
+using System.ComponentModel;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Represents a collection of parameters relevant to a <see cref="MySqlCommand"/> as well as their respective mappings to columns in a <see cref="DataSet"/>. This class cannot be inherited.\r
+ /// </summary>\r
+ /// <include file='docs/MySqlParameterCollection.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>\r
+ [Editor(typeof(ByteFX.Data.Common.DBParametersEditor), typeof(System.Drawing.Design.UITypeEditor))]\r
+ [ListBindable(true)]\r
+ public sealed class MySqlParameterCollection : MarshalByRefObject, IDataParameterCollection, \r
+ IList, ICollection, IEnumerable\r
+ {\r
+ private ArrayList _parms = new ArrayList();\r
+\r
+ #region ICollection support\r
+\r
+ /// <summary>\r
+ /// Gets the number of MySqlParameter objects in the collection.\r
+ /// </summary>\r
+ public int Count \r
+ {\r
+ get { return _parms.Count; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Copies MySqlParameter objects from the MySqlParameterCollection to the specified array.\r
+ /// </summary>\r
+ /// <param name="array"></param>\r
+ /// <param name="index"></param>\r
+ public void CopyTo( Array array, int index ) \r
+ {\r
+ _parms.CopyTo(array, index);\r
+ }\r
+\r
+ bool ICollection.IsSynchronized\r
+ {\r
+ get { return _parms.IsSynchronized; }\r
+ }\r
+\r
+ object ICollection.SyncRoot\r
+ {\r
+ get { return _parms.SyncRoot; }\r
+ }\r
+ #endregion\r
+\r
+ #region IList\r
+\r
+ /// <summary>\r
+ /// Removes all items from the collection.\r
+ /// </summary>\r
+ public void Clear()\r
+ {\r
+ _parms.Clear();\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets a value indicating whether a MySqlParameter exists in the collection.\r
+ /// </summary>\r
+ /// <param name="value">The value of the <see cref="MySqlParameter"/> object to find. </param>\r
+ /// <returns>true if the collection contains the <see cref="MySqlParameter"/> object; otherwise, false.</returns>\r
+ /// <overloads>Gets a value indicating whether a <see cref="MySqlParameter"/> exists in the collection.</overloads>\r
+ public bool Contains(object value)\r
+ {\r
+ return _parms.Contains(value);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the location of a <see cref="MySqlParameter"/> in the collection.\r
+ /// </summary>\r
+ /// <param name="value">The <see cref="MySqlParameter"/> object to locate. </param>\r
+ /// <returns>The zero-based location of the <see cref="MySqlParameter"/> in the collection.</returns>\r
+ /// <overloads>Gets the location of a <see cref="MySqlParameter"/> in the collection.</overloads>\r
+ public int IndexOf(object value)\r
+ {\r
+ return _parms.IndexOf(value);\r
+ }\r
+\r
+ /// <summary>\r
+ /// Inserts a MySqlParameter into the collection at the specified index.\r
+ /// </summary>\r
+ /// <param name="index"></param>\r
+ /// <param name="value"></param>\r
+ public void Insert(int index, object value)\r
+ {\r
+ _parms.Insert( index, value );\r
+ }\r
+\r
+ bool IList.IsFixedSize\r
+ {\r
+ get { return _parms.IsFixedSize; }\r
+ }\r
+\r
+ bool IList.IsReadOnly\r
+ {\r
+ get { return _parms.IsReadOnly; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Removes the specified MySqlParameter from the collection.\r
+ /// </summary>\r
+ /// <param name="value"></param>\r
+ public void Remove( object value )\r
+ {\r
+ _parms.Remove( value );\r
+ }\r
+\r
+ /// <summary>\r
+ /// Removes the specified <see cref="MySqlParameter"/> from the collection using a specific index.\r
+ /// </summary>\r
+ /// <param name="index">The zero-based index of the parameter. </param>\r
+ /// <overloads>Removes the specified <see cref="MySqlParameter"/> from the collection.</overloads>\r
+ public void RemoveAt( int index )\r
+ {\r
+ _parms.RemoveAt( index );\r
+ }\r
+\r
+ object IList.this[int index] \r
+ {\r
+ get { return this[index]; }\r
+ set \r
+ { \r
+ if (! (value is MySqlParameter)) throw new MySqlException("Only MySqlParameter objects may be stored");\r
+ this[index] = (MySqlParameter)value; \r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Adds the specified <see cref="MySqlParameter"/> object to the <see cref="MySqlParameterCollection"/>.\r
+ /// </summary>\r
+ /// <param name="value">The <see cref="MySqlParameter"/> to add to the collection.</param>\r
+ /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>\r
+ public int Add( object value )\r
+ {\r
+ if (! (value is MySqlParameter)) throw new MySqlException("Only MySqlParameter objects may be stored");\r
+\r
+ MySqlParameter p = (MySqlParameter)value;\r
+\r
+ if (p.ParameterName == null || p.ParameterName == String.Empty)\r
+ throw new MySqlException("Parameters must be named");\r
+\r
+ return _parms.Add(value);\r
+ }\r
+\r
+ #endregion\r
+\r
+ #region IDataParameterCollection\r
+\r
+ /// <summary>\r
+ /// Gets a value indicating whether a <see cref="MySqlParameter"/> with the specified parameter name exists in the collection.\r
+ /// </summary>\r
+ /// <param name="name">The name of the <see cref="MySqlParameter"/> object to find.</param>\r
+ /// <returns>true if the collection contains the parameter; otherwise, false.</returns>\r
+ public bool Contains(string name)\r
+ {\r
+ if (name[0] == '@')\r
+ name = name.Substring(1, name.Length-1);\r
+ foreach (MySqlParameter p in _parms)\r
+ {\r
+ if (p.ParameterName.ToLower().Equals( name.ToLower() )) return true;\r
+ }\r
+ return false;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the location of the <see cref="MySqlParameter"/> in the collection with a specific parameter name.\r
+ /// </summary>\r
+ /// <param name="parameterName">The name of the <see cref="MySqlParameter"/> object to retrieve. </param>\r
+ /// <returns>The zero-based location of the <see cref="MySqlParameter"/> in the collection.</returns>\r
+ public int IndexOf( string parameterName )\r
+ {\r
+ if (parameterName[0] == '@')\r
+ parameterName = parameterName.Substring(1, parameterName.Length-1);\r
+ for (int x=0; x < _parms.Count; x++) \r
+ {\r
+ MySqlParameter p = (MySqlParameter)_parms[x];\r
+ if (p.ParameterName.ToLower().Equals( parameterName.ToLower() )) return x;\r
+ }\r
+ throw new MySqlException("Parameter '" + parameterName + "' not found in collection");\r
+ }\r
+\r
+ /// <summary>\r
+ /// Removes the specified <see cref="MySqlParameter"/> from the collection using the parameter name.\r
+ /// </summary>\r
+ /// <param name="name">The name of the <see cref="MySqlParameter"/> object to retrieve. </param>\r
+ public void RemoveAt( string name )\r
+ {\r
+ int index = IndexOf( name );\r
+ _parms.RemoveAt(index);\r
+ }\r
+\r
+ object IDataParameterCollection.this[string name]\r
+ {\r
+ get { return this[name]; }\r
+ set \r
+ { \r
+ if (! (value is MySqlParameter)) throw new MySqlException("Only MySqlParameter objects may be stored");\r
+ this[name] = (MySqlParameter)value;\r
+ }\r
+ }\r
+ #endregion\r
+\r
+ #region IEnumerable\r
+ IEnumerator IEnumerable.GetEnumerator()\r
+ {\r
+ return ((IEnumerable)_parms).GetEnumerator();\r
+ }\r
+ #endregion\r
+\r
+ #region Public Methods\r
+\r
+ /// <summary>\r
+ /// Gets the <see cref="MySqlParameter"/> at the specified index.\r
+ /// </summary>\r
+ /// <overloads>Gets the <see cref="MySqlParameter"/> with a specified attribute.\r
+ /// [C#] In C#, this property is the indexer for the <see cref="MySqlParameterCollection"/> class.\r
+ /// </overloads>\r
+ public MySqlParameter this[int index]\r
+ {\r
+ get { return (MySqlParameter)_parms[index]; }\r
+ set { _parms[index] = value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Gets the <see cref="MySqlParameter"/> with the specified name.\r
+ /// </summary>\r
+ public MySqlParameter this[string name]\r
+ {\r
+ get { return (MySqlParameter)_parms[ IndexOf( name ) ]; }\r
+ set { _parms[ IndexOf( name ) ] = value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Adds the specified <see cref="MySqlParameter"/> object to the <see cref="MySqlParameterCollection"/>.\r
+ /// </summary>\r
+ /// <param name="value">The <see cref="MySqlParameter"/> to add to the collection.</param>\r
+ /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>\r
+ public MySqlParameter Add(MySqlParameter value)\r
+ {\r
+ if ( value.ParameterName == null ) throw new ArgumentException("parameter must be named");\r
+\r
+ _parms.Add(value);\r
+ return value;\r
+ }\r
+\r
+ /// <summary>\r
+ /// Adds a <see cref="MySqlParameter"/> to the <see cref="MySqlParameterCollection"/> given the specified parameter name and value.\r
+ /// </summary>\r
+ /// <param name="parameterName">The name of the parameter.</param>\r
+ /// <param name="value">The <see cref="MySqlParameter.Value"/> of the <see cref="MySqlParameter"/> to add to the collection.</param>\r
+ /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>\r
+ public MySqlParameter Add( string parameterName, object value )\r
+ {\r
+ return Add( new MySqlParameter( parameterName, value ) );\r
+ }\r
+\r
+ /// <summary>\r
+ /// Adds a <see cref="MySqlParameter"/> to the <see cref="MySqlParameterCollection"/> given the parameter name and the data type.\r
+ /// </summary>\r
+ /// <param name="parameterName">The name of the parameter.</param>\r
+ /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>\r
+ /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>\r
+ public MySqlParameter Add(string parameterName, MySqlDbType dbType)\r
+ {\r
+ return Add(new MySqlParameter(parameterName, dbType));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Adds a <see cref="MySqlParameter"/> to the <see cref="MySqlParameterCollection"/> with the parameter name, the data type, and the column length.\r
+ /// </summary>\r
+ /// <param name="parameterName">The name of the parameter.</param>\r
+ /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>\r
+ /// <param name="size">The length of the column.</param>\r
+ /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>\r
+ public MySqlParameter Add(string parameterName, MySqlDbType dbType, int size)\r
+ {\r
+ return Add(new MySqlParameter(parameterName, dbType, size ));\r
+ }\r
+\r
+ /// <summary>\r
+ /// Adds a <see cref="MySqlParameter"/> to the <see cref="MySqlParameterCollection"/> with the parameter name, the data type, the column length, and the source column name.\r
+ /// </summary>\r
+ /// <param name="parameterName">The name of the parameter.</param>\r
+ /// <param name="dbType">One of the <see cref="MySqlDbType"/> values. </param>\r
+ /// <param name="size">The length of the column.</param>\r
+ /// <param name="sourceColumn">The name of the source column.</param>\r
+ /// <returns>The index of the new <see cref="MySqlParameter"/> object.</returns>\r
+ public MySqlParameter Add(string parameterName, MySqlDbType dbType, int size, string sourceColumn)\r
+ {\r
+ return Add(new MySqlParameter(parameterName, dbType, size, sourceColumn));\r
+ }\r
+\r
+ #endregion\r
+\r
+ }\r
+}\r
-0.65
-====================
-[done]Protocol compression
-[done]Support for GetSchemaTable
-[done]Named pipes for Windows working
-[done]Fix issue with ASP.Net data grid
-[done]Transactions
-[done]Fixed date/time handling
-MySqlCommandBuilder
-
-0.7
-=================================
-Support for all CommandBehaviors
-make XSD internal only
-Different character sets
-
-0.8
-================================
-Designer support for MySqlCommandBuilder
-
-0.9
-===============================
-?????
-
-1.0
-====================
-Oh yeah!
\ No newline at end of file
+1. implement connect timeout in ConnectionInternal\r
--- /dev/null
+// ByteFX.Data data access components for .Net\r
+// Copyright (C) 2002-2003 ByteFX, Inc.\r
+//\r
+// This library is free software; you can redistribute it and/or\r
+// modify it under the terms of the GNU Lesser General Public\r
+// License as published by the Free Software Foundation; either\r
+// version 2.1 of the License, or (at your option) any later version.\r
+// \r
+// This library is distributed in the hope that it will be useful,\r
+// but WITHOUT ANY WARRANTY; without even the implied warranty of\r
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU\r
+// Lesser General Public License for more details.\r
+// \r
+// You should have received a copy of the GNU Lesser General Public\r
+// License along with this library; if not, write to the Free Software\r
+// Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA\r
+\r
+using System;\r
+using System.Data;\r
+\r
+namespace ByteFX.Data.MySqlClient\r
+{\r
+ /// <summary>\r
+ /// Represents a SQL transaction to be made in a MySQL database. This class cannot be inherited.\r
+ /// </summary>\r
+ /// <include file='docs/MySqlTransaction.xml' path='MyDocs/MyMembers[@name="Class"]/*'/>\r
+ public sealed class MySqlTransaction : IDbTransaction\r
+ {\r
+ private IsolationLevel _level;\r
+ private MySqlConnection _conn;\r
+ private bool _open;\r
+\r
+ internal MySqlTransaction() \r
+ {\r
+ _open = true;\r
+ }\r
+\r
+ #region Properties\r
+\r
+ /// <summary>\r
+ /// Gets the <see cref="MySqlConnection"/> object associated with the transaction, or a null reference (Nothing in Visual Basic) if the transaction is no longer valid.\r
+ /// </summary>\r
+ public IDbConnection Connection\r
+ {\r
+ get { return _conn; } \r
+ set { _conn = (MySqlConnection)value; }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Specifies the <see cref="IsolationLevel"/> for this transaction.\r
+ /// </summary>\r
+ public IsolationLevel IsolationLevel \r
+ {\r
+ get { return _level; }\r
+ set { _level = value; }\r
+ }\r
+\r
+ #endregion\r
+\r
+ void System.IDisposable.Dispose() \r
+ {\r
+ }\r
+\r
+ /// <summary>\r
+ /// Commits the database transaction.\r
+ /// </summary>\r
+ public void Commit()\r
+ {\r
+ if (_conn == null || _conn.State != ConnectionState.Open)\r
+ throw new InvalidOperationException("Connection must be valid and open to commit transaction");\r
+ if (!_open)\r
+ throw new InvalidOperationException("Transaction has already been committed or is not pending");\r
+ Driver d = _conn.InternalConnection.Driver;\r
+ try \r
+ {\r
+ d.Send(DBCmd.QUERY, "COMMIT");\r
+ _open = false;\r
+ }\r
+ catch (MySqlException ex) \r
+ {\r
+ throw ex;\r
+ }\r
+ }\r
+\r
+ /// <summary>\r
+ /// Overloaded. Rolls back a transaction from a pending state.\r
+ /// </summary>\r
+ public void Rollback()\r
+ {\r
+ if (_conn == null || _conn.State != ConnectionState.Open)\r
+ throw new InvalidOperationException("Connection must be valid and open to commit transaction");\r
+ if (!_open)\r
+ throw new InvalidOperationException("Transaction has already been rolled back or is not pending");\r
+ Driver d = _conn.InternalConnection.Driver;\r
+ try \r
+ {\r
+ d.Send(DBCmd.QUERY, "ROLLBACK");\r
+ _open = false;\r
+ }\r
+ catch (MySqlException ex) \r
+ {\r
+ throw ex;\r
+ }\r
+ }\r
+ }\r
+}\r
-Managed Drivers for MySQL and PostgreSQL
-======================================
-
-Current Status of MySQL driver
-----------------------------------
-The driver is currently under heavy development.
-The driver is in beta form with most features working reasonably well.
-
-** Please note that the binaries distributed in the package are either
-compiled with Mono or .NET 1.1. **
-
-
-Current status of the PostgreSQL driver
----------------------------------------
-The PostgreSQL driver is just starting and not really usable yet.
-It can perform simple reads with a limited set of data types.
-Watch the project over the next few weeks to see much
-improvement.
-
-
-Credit
----------------------------------------
-First of all, many thanks to the MySQL folks for creating such a great database.
-
-Next, I have to give a big thanks and kudos to Mark Matthews for his Java-based MySQL driver.
-As the protocol to MySQL is very poorly documented, his driver proved to be invaluable.
-
-Also, I have to give thanks for Jun Su for starting the SourceForge project and for his wonderful
-contribution of code and ideas.
-
-Thanks also go out to Peter Belbin, Timoth Parez, and Daniel Morgan for their input, testing, and all
-the other things that make open source projects successful!
-
-I have started putting the names of people who post bugs, patches, suggestions, or anything else of value to the changelog.
-If you have posted and don't see your name, I apologize. Please let me know who you are and I'll include you.
-The most important thing here is to understand that this is not a one man show. So many people have provided input
-along the way.
-
-
-
-
+Managed Drivers for MySQL and PostgreSQL\r
+======================================\r
+\r
+Current Status of MySQL driver\r
+----------------------------------\r
+The driver is currently under heavy development.\r
+The driver is in beta form with most features working reasonably well.\r
+\r
+** Please note that the binaries distributed in the package are either\r
+compiled with Mono or .NET 1.1. **\r
+\r
+\r
+Current status of the PostgreSQL driver\r
+---------------------------------------\r
+The PostgreSQL driver is just starting and not really usable yet. \r
+It can perform simple reads with a limited set of data types.\r
+Watch the project over the next few weeks to see much \r
+improvement.\r
+\r
+\r
+Credit\r
+---------------------------------------\r
+First of all, many thanks to the MySQL folks for creating such a great database.\r
+\r
+Next, I have to give a big thanks and kudos to Mark Matthews for his Java-based MySQL driver.\r
+As the protocol to MySQL is very poorly documented, his driver proved to be invaluable.\r
+\r
+Also, I have to give thanks for Jun Su for starting the SourceForge project and for his wonderful\r
+contribution of code and ideas.\r
+\r
+The following people have also contributed and their additions have been greatly appreciated.\r
+=================\r
+Timothy Parez\r
+Peter Belbin\r
+Daniel Guisinger\r
+Steve M. Brown\r
+Clint Kennedy\r
+Matthew J. Peddlesden\r
+Daniel Morgan\r
+Rory Plaire\r
+Marco Poponi\r
+Mark Reay\r
+\r
+....just to name a few. Many people have contributed either through code, testing, or bug reports. If I have left\r
+your name off, it is not intentional and I apologize. Thank you to everyone who has contributed and continues\r
+to contribute to this project.\r
+\r
+\r
+I have started putting the names of people who post bugs, patches, suggestions, or anything else of value to the changelog.\r
+If you have posted and don't see your name, I apologize. Please let me know who you are and I'll include you.\r
+The most important thing here is to understand that this is not a one man show. So many people have provided input\r
+along the way.\r
+\r
+Reggie Burnett\r
+ByteFX, Inc.\r
+\r
+\r
+\r
+\r
projects / mono.git / commitdiff
